CAZyme Information: MGYG000002785_00133

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella
• CAZyme ID: MGYG000002785_00133
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769		86359.49	4.011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002785	1782446	MAG	United States	North America

• Gene Location: Start: 2228; End: 4537 Strand: -

Full Sequence      

MKKVWKKTCAAVCSAAMALSATSVAFAAEDAEQELRMQYGNALDIYANPTEDLYGDYSTN
KYNNFSDMGAWHGYYLPEEDEIDIQGGFAGPVIVAEEYPVNLSGAFSKLEITKADGTVYS
YEDAKASGVYYPGKLVQTYDFEDITVNMELIFGSDRTALIKTEIVNKTEEPVELKLKWHG
DMYTNYGNEEKVMGNNLEATEDGVQVNFTEIRETWNYLMTDEVKFNVRRDIPVTTTVEGD
SYVTEAKDAVTIAAGESFQTLSTETYTFTAEEAAEEKEAAADMLANSDSYFTANADRWNG
YVETVEKDGVAHQYKKAAVKSIETMMTNYMSAAGDLIHGGVVPSMSYKWFIGLWAWDSWK
QVVGMAPYDAEIAMENVRSIFDYQIQPDDEVRPQDAGTIIDCIFFNKGPERGGDGGNWNE
RNSKPPLAAWAVYNAYEASQDKEFLEEMYPKLVAYHNWWYTNRDIDGNGVAEYGAMVHDA
HYQYDEEGNIVKDENGNPLVDPEAVIEAAAWESGMDNAPRFDISGNGPEDVGTLVYEVKN
DDGEVVGYTINQESVDLNSYLYAEKGFLKTMAEELGLEEDAAKYEAEAATLKEYINTNMY
DEETGFYYDLQINEDGSEKKLLVNRGKGSEGWLPLWAKLATQEQADRVVENMMDEEKFNL
VVPLGVTSKDNDMFMPAKYWRGPVWMDQAMFGAEAMQNYGYHEEAQEMVLKMFVNAEGLL
SDGPIRENYNPLTGEGLHTKNFSWSAASFYLLYQNVLTGNETTSQTGLE

Enzyme Prediction     

No EC number prediction in MGYG000002785_00133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	6	757	5.2e-201	0.9929824561403509

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	6	758	3	785	alpha-glucosidase; Provisional
pfam01204	Trehalase	3.66e-15	423	748	178	500	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.37e-12	347	757	279	608	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	1.89e-12	555	746	252	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	6.37e-10	423	668	203	448	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY84390.1	0.0	37	768	39	777
AQM60257.1	0.0	37	768	39	777
QEK21330.1	0.0	39	769	47	802
QQY26327.1	0.0	39	769	41	795
QQV06747.1	0.0	39	769	41	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.84e-168	61	755	28	755	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.27e-167	61	755	28	755	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	4.61e-167	61	755	28	755	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	3.53e-160	39	755	6	756	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	1.16e-90	61	481	354	774	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	6.37e-167	61	755	51	778	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8T3S4	6.09e-19	354	747	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
D8QTR2	1.08e-18	354	747	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
Q757L1	2.62e-08	554	751	479	701	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
P49381	3.49e-08	554	751	495	717	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000616	0.997996	0.000349	0.000361	0.000336	0.000296

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002785_00133.