CAZyme Information: MGYG000002780_00544

Basic Information

• Species: Fournierella sp004558145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Fournierella; Fournierella sp004558145
• CAZyme ID: MGYG000002780_00544
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650		72429.94	6.3835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002780	2558178	MAG	United States	North America

• Gene Location: Start: 955; End: 2907 Strand: +

Full Sequence      

MRPRNSQEAGPLAVLRARDKGENDPMPDKKELEAPLPADVAREDSVGGMARRLLDPAHIK
QVAAWCAQVGREEGLEALWREVEFRIRLALHRDTWRYRADLPTRRQLKAQRAENLAGPTI
SVCVPLFNTPAPFLRQMINSVLAQSYQRWELVLADASDDAHSDVGRIAQGFAQKDSRIRY
LKLEENGGIAANTNAALAAATGDWLTLLDHDDVLYANALYRVAKEALAGADFVYSDEIVL
SADLKHLVDYHFKPDFEPDYLRGCNYITHLAAFSRALFERAGGGERSEYDGSQDFEIILR
LTEHAQKVTHIPYVLYIWRSHSGSTASGMEAKPYALAAGEKAIDDHLKRVGLEGTAKRIE
GCPGAYRVKYALTGTPLISVLIPNKDHIEDLDRCLASLYAKAGYDNFEVIVAENNSADPA
TFEYYEAAKKKYPRLQVVTYEGGFNFSAVNNFARRFAKGEQLLLLNNDIELLSEGFLAEM
LMFSQRPDVGCVGAKLYYPDDRIQHAGVFLGIGGTAGHSHKSHPRASAGDLYRLATPQNL
LAVTGACLMVKAALYDGMGGLDEENFAVAYNDIDLCLKLWKKGLTNVFTPHAEAYHYESK
SRGLDTLSENARRYEGEKARFIAKYGDMIAAGDPYYNRHFNLLFENYGLK

Enzyme Prediction     

No EC number prediction in MGYG000002780_00544.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	121	234	1.2e-25	0.6588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.62e-73	118	319	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	5.16e-39	380	598	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.01e-25	374	644	1	262	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.25e-17	121	278	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	3.10e-15	122	301	1	147	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66692.1	1.84e-184	91	650	391	946
ATO99477.1	3.66e-183	107	650	260	804
QIA42131.1	3.66e-183	107	650	260	804
ATL89683.1	3.66e-183	107	650	260	804
CBK99960.1	1.42e-182	107	650	259	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.91e-09	117	221	4	107	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.40e-128	117	637	365	885	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.81e-88	118	650	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	2.58e-12	120	225	5	110	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P77414	7.31e-10	117	334	4	224	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
P71054	1.75e-09	116	221	3	106	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002780_00544.