CAZyme Information: MGYG000002779_00914

Basic Information

• Species: Holdemania sp900120005
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania sp900120005
• CAZyme ID: MGYG000002779_00914
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000002779_6|CGC2	56308.06	5.8937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002779	3078380	MAG	United States	North America

• Gene Location: Start: 116048; End: 117499 Strand: -

Full Sequence      

MEKEKYKFPQDFLWGGATAACQIEGAYDVEGRGLSTSDIHLYNDQLDRIRYRKKLVENEH
TSATLAAAVADQEGYYPKRYGNGFYYRYKEDIALMKEMGMNSFRFSIAWPRIFPRGDERE
PNEKGLQFYDRVIREVIDAGMEPIVTMFHYDIPLPLLTEYGGFKNPQLIEFMVRYAKVLL
DRYGYLVKYWIPFNQTNLVQYCSFKSLGILRDKTENLIEDQYIAIHHQFLCNAQIKAYAK
KINPNIQIGIMLADCTYYPATCRPEDIVFAMKRIRMQYFYADVPLRGEYPGFMLRYFKEN
DIHVDITEADKALLKENTLDFLAFSYYYSRTLDSQKNTMDPASISENPYLKANAWGWTID
PLGMYNAISQYWDRYQKPIMIAENGFGYEDVFVDGTVHDDYRIDYLRQHIQAVSEALQDG
VKVLAYLPWGPIDLVSSGTAEMSKRYGFVYVDLDDHGKGTGNRFKKDSFAWYQKVIASRG
SEL

Enzyme Prediction     

No EC number prediction in MGYG000002779_00914.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	480	1.2e-135	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	5	482	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	5.73e-175	7	483	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	2.13e-172	5	483	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	3.47e-171	4	483	2	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.47e-149	4	483	2	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK89201.1	1.56e-216	8	483	8	481
QIX10523.1	1.28e-215	12	483	12	481
QYK62200.1	2.51e-213	1	483	1	481
APB71184.1	1.02e-212	1	483	1	481
AYJ46888.1	3.01e-212	5	483	7	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	5.66e-156	1	483	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.19e-147	7	483	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.39e-147	7	483	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	4.06e-143	7	483	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
4IPL_A	1.17e-141	8	483	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	5.86e-158	1	483	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	4.69e-148	8	483	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	1.25e-145	8	483	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	4.04e-141	8	483	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	9.85e-141	4	483	4	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002779_00914.