CAZyme Information: MGYG000002774_02131

Basic Information

• Species: Schleiferilactobacillus harbinensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Schleiferilactobacillus; Schleiferilactobacillus harbinensis
• CAZyme ID: MGYG000002774_02131
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000002774_10|CGC1	75748.17	5.6994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002774	3078759	MAG	United States	North America

• Gene Location: Start: 25223; End: 27217 Strand: -

Full Sequence      

MQPNIQFGVDYYPEHWPQSRWETDFAMMQDMGIDVVRLGEFSWFKLEPADGQFDFGWLDD
VLVLAAKHDIHAVLGTPTAAPPAWLIAQHPDIQPVDREGRTRYFGGRHHDCQSNPIYRDY
IARFVRTYAQHFGKNPTVIGWQVDNELGNSHGGLCYCKYCQRHFQKWLREKYQTIENLND
NWGTAFWSQGYQDFSQIQAPKITVTGENPSEMLDWKECHSDLINEFHAYQAKIIRQYSPD
RFITHNMMGFSPVVSYYNLGRQLDFASHDQYPSGHFLADQNSFRGDRCAAELDFIRGVKQ
QTFWIMEQQTTITGWEVMGRLPKPGQIPLWSMQSVAHGADAIVYFRWRSSALGTEQYWHG
ILPHSGIPGRAYREIRHFMHQTKPLLKEINGTVPRAKVGIVFSYPQDYAIDIQPQHPDMT
YVDTLMTYYKALYRRNVAVDFIQDTADFSQYELVIAPLQYLMTPTLADRYAAYVQAGGQL
VLTMRTGVKEANNLCMTDAALPGKTLGQVLGLTVPEYDCLRDVDVVIDWAGQQYTGTHWA
DLIAPTTAEPLATYGSEFYAGTPAITKNHYGAGTTYYVGTELTDDLADRLVAGLPTVAAE
TIATPAEVEIVHRDAAAKRYYFVLNHTGEQQNITIPIGWQAYFSDQDAGHLAPYSYQVFT
EEKN

Enzyme Prediction     

No EC number prediction in MGYG000002774_02131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	10	381	8.9e-146	0.9892183288409704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	7.88e-162	10	378	1	369	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	1.16e-143	8	640	19	648	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	2.89e-61	396	594	1	200	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	5.27e-25	398	531	1	134	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG3934	COG3934	0.001	11	181	19	176	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU47466.1	0.0	1	664	1	664
QFR24549.1	0.0	1	663	1	663
QFR62998.1	0.0	1	664	1	664
BCJ94071.1	1.92e-254	4	659	3	661
AGB41273.1	1.11e-178	5	635	1	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	1.82e-134	5	594	1	607	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
3TTS_A	2.25e-128	3	630	7	639	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
1KWG_A	4.73e-122	8	594	3	583	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
5E9A_A	1.35e-114	8	640	42	684	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
6Y2K_A	2.32e-112	5	638	1	641	ChainA, beta-galactosidase [Marinomonas sp. ef1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D9SM34	9.86e-155	5	585	1	576	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
P94804	6.74e-144	8	636	4	631	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
B9LW38	9.97e-134	5	594	1	607	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
P19668	7.31e-129	4	636	6	634	Beta-galactosidase bgaB OS=Geobacillus kaustophilus OX=1462 GN=bgaB PE=1 SV=1
C9S0R2	4.06e-128	4	636	6	634	Beta-galactosidase BgaB OS=Geobacillus sp. (strain Y412MC61) OX=544556 GN=bgaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002774_02131.