CAZyme Information: MGYG000002772_01236

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter
• CAZyme ID: MGYG000002772_01236
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000002772_150|CGC1	45570.98	5.0972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002772	2925670	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 4380; End: 5585 Strand: -

Full Sequence      

MLYDYYGSKDMLACHYPLMKDWVDCIRREDQNRGEKHLWDFGFQFGDWLALDGATEQSTF
GATDSGYIASVYYYASTSYVAKAAKVLGYEEAKEYEQLAESIKTAILDEYFTTSGRIAVD
TQTGYLVALKFGIYRDKNKMIEALRTRIKKDCYRIKGGFVGATMMNTVLADCGMEDLAYD
FLFFEGFPGWLYAVNLGATTIWERWNSILPDGKISGTGMNSLNHYSYGSVMEFVYRHSMG
LIPVEPGFKKVCLAPKPDVRMGYFKGSFDSAAGRYVSQWEIKKNGVLSFHIEIPFGCEAE
VVLPEQEAKVLPAGSYDFEIMTKRDYLALYSGTTPVERLLDNPKAVEILDKYLPGYIASI
DRNDLEAMNKSIVDQRTRAMLFRQPTESYEKAIEEISKIHV

Enzyme Prediction     

No EC number prediction in MGYG000002772_01236.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	2	303	6.4e-77	0.5734126984126984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.98e-66	1	237	109	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.34e-16	240	307	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ52111.1	1.92e-128	1	399	516	916
BBF42778.1	2.37e-125	2	401	526	927
AFN57707.1	4.88e-122	6	401	524	919
AYH41563.1	1.98e-114	2	376	515	891
QIZ07546.1	2.55e-104	2	364	535	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.26e-40	2	304	706	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.99e-37	2	315	538	858	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	2.73e-28	2	305	572	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	7.46e-45	2	321	576	911	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	1.19e-43	7	352	585	924	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	3.95e-39	2	304	706	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.04e-14	3	336	606	939	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002772_01236.