CAZyme Information: MGYG000002770_00635

Basic Information

• Species: Catenibacterium sp900764725
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium sp900764725
• CAZyme ID: MGYG000002770_00635
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000002770_27|CGC1	55844.16	6.0702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002770	2354150	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 69; End: 1511 Strand: -

Full Sequence      

MQAEKKPMTKKQYLEKSKKFDSLRDKVAADPYRMKYHLQPPIGWLNDPNGLCQIGNQYHI
CFQYTPFNPNGGTGLWGHMVTEDFIHYEEHEPSIFPDSCWDANGAYSGSAYEEDGEYYFF
YTGNVKYEGKDYNYVTDGREQNVILTTTKDGYIFSEKKLIMTNDNFPEDLSKHVRDPQII
KKGNHYYMILGARDLLNKGSVLLFKSDDLYHWKYELRFTTQQVFGYMWECPNYVEIEGKQ
FLIVCPQGIEQDGLDYANAHQCGYFPLKYEFKDKIYQLGEFYQLDRGFDFYAPQIFKDHT
GRVILLGWMGMPDSDYSNDETVKNGWQHALSIPRELYVTEKGKLAQKPLDELKKLRSNEK
KIEFHTGFSTSTSVCFEMEINFETSKDFILKLRESVKLRYKEGILTLDITHCGSGRKQRG
VAINTIADIRIFSDSSSLEIFINGGEVVFTTRIYDSMKELSCKLKSENLNGVVKYYDLNS

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	348	4.5e-87	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	9.30e-147	43	338	1	287	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.27e-139	23	454	4	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	4.33e-129	14	475	10	479	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	5.21e-104	37	445	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	4.60e-98	37	348	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19049.1	5.56e-174	8	478	1	461
QCP34478.1	5.31e-169	24	478	24	478
QMW71993.1	6.10e-168	21	478	21	478
BCD35034.1	6.10e-168	21	478	21	478
ALQ40753.1	3.41e-166	8	480	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.71e-68	32	468	25	472	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NU7_A	1.98e-60	9	454	4	462	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7BWB_A	2.38e-52	26	454	41	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.34e-51	26	454	41	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	1.48e-50	32	454	2	405	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.20e-94	29	454	25	453	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	4.77e-84	21	478	22	489	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P27217	1.24e-75	27	454	21	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	1.56e-72	26	454	20	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P13394	1.03e-70	36	463	40	463	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002770_00635.