CAZyme Information: MGYG000002768_00235

Basic Information

• Species: UBA4636 sp900764595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA4636; UBA4636 sp900764595
• CAZyme ID: MGYG000002768_00235
• CAZy Family: GH13
• CAZyme Description: Pullulanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887	MGYG000002768_25|CGC1	98754.33	6.1061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002768	1521598	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 1298; End: 3961 Strand: -

Full Sequence      

MKKVLTMILFVVMVLCVTLVACNKGPSMTGEGEFAYQPFSGTNSFSNEKVLPTDLPENLT
EPTLQIHYYRKNSADYKKWGFWLWAKGGEGKLFNLNYQDDFGGIALYKLSEIGSGAEQKG
IGVIPRLQSGWTKDGDADREIDFKQLTLQNNCYHVYVIQGDINVYTTLDDQLKQRVVDLK
YGVNAEFTDEQNISIKTETPVKKVEILHGQDVLGGTDTELTALITYKFKKGSKAKIGDEY
FARVVFEDGKTVTQNIAITNLFGTESFDRAYYYDGELGALYEKEATTFRVWSPVSTKIVL
NIYQKGDGAETPEKTEMTKGEKGVFETRLSGNMAGKYYTYTVYNSAYPGGREVVDPYAKS
AGLSGVRGQIVDFSDTNPDGWDKIKPHAYNRKSLTVWETHVSDVTSSQTWKGTEKNRKKF
LGMAESGTTYTKDGVTVKTGFDHIKELGVNAVQLVPVFDQANDESVMKFNWGYNPLNYNV
LEGSYSSDPTDGYVRIREFKQLVKAYNEAGINIIMDVVYNHVAAASGSNFDVLMPGYYFR
YTKTGAFSNGSGCGNETASDHSMFRKFIIDSVCFWAKEYKLGGFRFDLMGVHDIDTMNKL
NAELKKINSSIVVYGEPWEGGTCALAQSKQADQSNGNLLTVGQFSDQFRDALIKGGMNDK
KNLGWVTNIGAVDTNDLSRIVAGLKGQIYTGSLTITSPDKVVNYVTCHDNYTLYDRIVAT
GEYETISHADMIKKMAVLADAMVFTANGTSFMLAGDEFLRTKGGDSNSYESSYKVNELDY
SLKIKHYDVFENFKKLIAFKQTCKALQYDENQISLYKVSTINGGATIQITFTVDGKNYKI
IHSNSAVKGKNYTADFAGYTLYLDTVGDGALSANTPLLPYQTIIAYK

Enzyme Prediction     

EC	3.2.1.1	3.2.1.41

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	442	757	5.9e-100	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11341	AmyAc_Pullulanase_LD-like	0.0	396	800	5	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
TIGR02104	pulA_typeI	0.0	266	800	1	526	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
COG1523	PulA	8.64e-116	269	809	59	594	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
PLN02877	PLN02877	3.08e-85	268	781	206	798	alpha-amylase/limit dextrinase
TIGR02102	pullulan_Gpos	1.18e-79	30	762	100	814	pullulanase, extracellular, Gram-positive. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. In contrast, a glycogen debranching enzyme such GlgX, homologous to this family, can release glucose at alpha,1-6 linkages from glycogen first subjected to limit degradation by phosphorylase. Characterized members of this family include a surface-located pullulanase from Streptococcus pneumoniae () and an extracellular bifunctional amylase/pullulanase with C-terminal pullulanase activity (.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS39053.1	2.17e-254	18	887	15	887
VEU82346.1	1.14e-176	61	868	28	859
QLY39684.1	1.81e-169	66	844	75	879
QWB95757.1	3.43e-169	60	881	25	895
BCR36445.1	8.40e-168	50	845	21	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LSA_A	3.10e-122	247	884	31	709	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	4.56e-121	247	884	31	709	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	4.80e-121	247	884	31	709	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	4.92e-121	247	884	31	709	ChainA, Pullulanase [Ruminococcus bromii]
2WAN_A	3.50e-118	60	800	3	824	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	2.24e-118	60	827	19	772	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	2.35e-92	255	807	84	620	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
P07811	3.09e-59	278	789	315	929	Pullulanase OS=Klebsiella aerogenes OX=548 GN=pulA PE=1 SV=1
Q8GTR4	1.61e-58	268	789	199	799	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
P07206	3.18e-58	278	789	305	919	Pullulanase OS=Klebsiella pneumoniae OX=573 GN=pulA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000018	1.000043	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29