CAZyme Information: MGYG000002766_00551

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000002766_00551
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000002766_55|CGC1	56840.68	4.544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002766	1779658	MAG	Netherlands	Europe

• Gene Location: Start: 2493; End: 3971 Strand: +

Full Sequence      

MSKLKHGFDSDFLWGGAISCSQADGAWNEGGKGKSTQDCRWLDGTWTHDQIEDKHQNNPF
CHDELMNALADDGVEFYPFRRGNDFYHHYREDIALFAEMGLKLFRTSICWSRIYPNGDDL
EPNREGIEWYRSMLGECKKHGIKTFVTMLHYDIPVNLVTTYGGWKNRKTIDFFARYVETI
VTELGDLVDFWLPFNEFNAARFSPWDGVCLVKDEEGENFDRAIFQCLHHEFVANARAVEI
VHRLSPDTPVGGMIARFCTYPATCRPEDNMQAIHDDQYSNWFYTDVMARGKYPAYMNRYF
DACDIEIQMEPGDEELIARNTVDFLAFSYYFSQVSTCDQGWEKTAGNLVMANKNPYLETS
EWGWQLDPIGLRVTLNQMYDRYGLPLYIAENGLGTSDVVEEDGSIHDEYRIDYLRQHIKC
LKEAVIDGVDVRGYMIWGFIDLVACGPLTMDKRYGLIYVDLDNCGNGTAERSRKDSFYWY
QKCIATNGEDLG

Enzyme Prediction     

No EC number prediction in MGYG000002766_00551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	488	4.3e-135	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	8	492	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	8	490	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	2.63e-178	5	491	3	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	6.18e-175	7	491	3	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.32e-149	1	491	1	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61128.1	0.0	4	491	2	489
QUC02549.1	5.17e-299	4	491	1	488
QNM12924.1	2.79e-282	4	492	1	488
QYN59590.1	2.12e-254	4	484	1	480
QYN52654.1	2.20e-254	4	484	2	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	4.61e-175	1	491	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.32e-142	11	491	11	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.06e-137	1	491	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.01e-137	1	491	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	1.51e-136	8	491	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.66e-172	1	491	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.21e-168	8	491	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	4.39e-148	8	491	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P26206	6.75e-148	4	491	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P42973	4.93e-146	11	491	7	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002766_00551.