CAZyme Information: MGYG000002739_00036

Basic Information

• Species: Collinsella sp900551605
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900551605
• CAZyme ID: MGYG000002739_00036
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		60825.8	4.301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002739	1755421	MAG	Netherlands	Europe

• Gene Location: Start: 19925; End: 21547 Strand: +

Full Sequence      

MDMTLNQDAVAEIWRPVVLTFESACSFDNPFLDVEIWAEFTGSSDRVIRREAYWDGGRTY
CVSFAPTELGAWNYVIEAPEQTGLNGCTGRVEAVPYAGDLDLYRHGFIRVADDSRMFAYS
DGTPFFWLGDTHWEFAYRESWDASNHPGMTSQFRGMVDLRAEQGFTVYQTNLRSDMGAGD
RYWIDGGMAKGVEDVPNVAFYQRELDRRMAYIADAGLVNALGQAWAFAILGEHAVEHQKH
LARYLVARYGAYPMVWTLAGEVAGYRKEGRAAMLDGWREVALEIEARDGYGHLATAHYTN
ERPFADYYQDEPWMDFTLNQAGHGDYIIKASDYFDYLAAHDDKPFVEGEALYEFCSTLEE
MGTRLCTADMLRRVAYICMQAGGAGYTYGAQGIWDNVWESPEELDPFMAIFNRFGITWAQ
AVDGEGAVQMGYMRSFYEDNHFWELAPYETTDAGNLFANKAPLATANQDLSRIVAYFGDT
VRQKLAIEGVPTGAAYASRWFNPRTGAYRDGEDVLAVTDSITLPDKPGVGDWLLVLELKA

Enzyme Prediction     

No EC number prediction in MGYG000002739_00036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	106	532	1.7e-82	0.9927184466019418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.52e-67	113	438	1	318	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam16586	DUF5060	5.52e-20	12	78	3	69	Domain of unknown function (DUF5060). This is the N-terminal domain of a putative glycoside hydrolase, DUF4038. It is found in a number of different bacterial orders.
pfam12904	Collagen_bind_2	0.008	492	537	45	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54502.1	0.0	1	540	1	540
AQR97270.1	5.28e-219	12	537	9	532
QTH41603.1	8.75e-115	6	537	35	556
QUC02871.1	8.81e-113	156	536	1	384
QTH45264.1	2.58e-77	12	537	41	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	5.15e-24	103	506	13	413	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.26e-22	103	478	13	388	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	1.57e-16	103	506	26	429	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002739_00036.