CAZyme Information: MGYG000002738_01372

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia
• CAZyme ID: MGYG000002738_01372
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	MGYG000002738_27|CGC2	88616.62	4.5261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002738	3492433	MAG	Netherlands	Europe

• Gene Location: Start: 30939; End: 33302 Strand: +

Full Sequence      

MRFRGKWKGMLILCGILMTTVSGGCGVGAGDSKNLLLHLKFDEKAGTAIEDSSQKTKQGE
VNYRYTHAVYTEKKEPEWRVKGVDKGCLLFDGNSTYIEYTPEEICVEGKAFSVSVWVAPR
AFEWDDPQAAEKGEEHLTAIAGQFNKEKKEGFLLGYQRFGRLCFQIGTGDSWITLWGEGE
NLQKYQWNQVTAVFDGKNGNISLFLNGEQIGCQKIEKNTEIKPAKKEKLFIGKNPEAEQI
AAGTYNMFSGLMDDLKIYPYALREEEIPNKEAPEIEFEDIRLENILTDDIYKTQFHGGPY
QHWMNEPHAPFYYNGMYHLFYQCNPVGTYWRNICWGHLVSEDMVNWKPIKEAITPTENSV
APDGIWSGGAAIDKNGVPLLFFTAGNDSFLEDGLISNQNIGVAYPADLSDPYLTDWVMAE
ELAVKQEEGQGRTGEFRDPHIWKEGNVWNMLVCSGSTESQGGSALLYQTEKLELRDDKTI
DMAWQYKGPVYEMENPSVTYGTSWELPIILPVSNEAGTISRHIFLMSPAPAGVADNKIYY
FLGDFDVKTGKFTPDETFDNQPGLLDYGSNVFTGPSAFLDSESEKLCMFSIMQDQRSGAE
EGAAGWAHCVGLTRNLWLNDEGTDIMMAPDSHLDSLKNHILIEEENLSLEKANEQLAKVK
GDLLYVEAVLDLENAEEFGIRLKTDGKRNEVSYVYNCEENSIAGHTRNKGKTASSSHVSG
PLLLENGKLTMKIYVDRSLIEGYFNDRKSISIRDYGEYEAQGMQFFGQGDILVERLYVSE
MKSIYEK

Enzyme Prediction     

EC	2.4.1.-	3.2.1.26	3.2.1.7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	296	627	1.6e-59	0.9897610921501706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08996	GH32_FFase	1.23e-84	302	618	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.72e-75	299	746	4	436	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	3.76e-58	299	629	4	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
cd18624	GH32_Fruct1-like	3.16e-52	302	618	1	296	glycoside hydrolase family 32 protein such as Arabidopsis thaliana cell-wall invertase 1 (AtBFruct1;Fruct1;AtcwINV1;At3g13790). This subfamily of glycosyl hydrolase family GH32 includes fructan beta-(2,1)-fructosidase and fructan 1-exohydrolase IIa (1-FEH IIa, EC 3.2.1.153), cell-wall invertase 1 (EC 3.2.1.26), sucrose:fructan 6-fructosyltransferase (6-Sst/6-Dft, EC 2.4.1.10), and levan fructosyltransferases (EC 2.4.1.-) among others. This enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	2.25e-51	289	746	11	433	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD03331.1	4.18e-200	35	786	34	773
AAF24999.1	1.66e-169	31	785	5	757
AUS98640.1	1.96e-162	32	785	15	757
QQZ63908.1	4.14e-162	31	785	6	759
CQR54044.1	1.81e-160	31	785	6	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QQU_A	4.02e-39	291	676	4	382	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]
2XQR_A	2.50e-38	291	676	4	382	Crystalstructure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_C Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_E Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_G Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_I Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_K Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana]
2AC1_A	2.64e-38	291	676	8	386	Crystalstructure of a cell-wall invertase from Arabidopsis thaliana [Arabidopsis thaliana]
2OXB_A	6.13e-38	291	676	4	382	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]
2QQW_A	6.13e-38	291	676	4	382	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01IS8	4.13e-44	282	687	37	438	Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. indica OX=39946 GN=CIN3 PE=2 SV=2
Q0JDC6	4.13e-44	282	687	37	438	Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CIN3 PE=2 SV=1
B6DZD0	1.35e-42	290	682	60	426	Fructan 1-exohydrolase OS=Triticum urartu OX=4572 GN=1-FEH PE=3 SV=1
B6DZD1	4.39e-42	290	675	58	425	Fructan 1-exohydrolase OS=Aegilops speltoides OX=4573 GN=1-FEH PE=3 SV=1
B6DZD2	1.48e-41	290	678	59	434	Fructan 1-exohydrolase OS=Aegilops tauschii OX=37682 GN=1-FEH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000402	0.023234	0.976339	0.000010	0.000014	0.000013

TMHMM  Annotations     

start	end
9	31