CAZyme Information: MGYG000002737_00847

Basic Information

• Species: Prevotella sp900553465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553465
• CAZyme ID: MGYG000002737_00847
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795	MGYG000002737_20|CGC1	88944.76	5.5164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002737	2443712	MAG	Netherlands	Europe

• Gene Location: Start: 3161; End: 5548 Strand: +

Full Sequence      

MILLTALSSVTCLSQTLHDDISPVPFTNVHINDGFWSQRLDTMRNKTIRYAFRRCEEAGY
MRNFELAGKILSGELKKGEARFQSGSPFDDADLFKIIEGAAYILSVKEDPEFEKYIDSVI
DKIVEAQEPDGYLFTNRTIGNPVHDWVGTQRWVNDWNLSHETFNAGELYEAAVAYYAATG
KDKLLRAAVKNADLVCKVYNDNGLKLAPGHAVIEMALARLYETTGDSKYLDLCKFFIDCR
GQKKFDSSSSDIRANGMYWQNHLPATEQREAVGHAVRALYFYSGMADAVLLGGHKEYVEA
INAIWENIVSKKLYITGGLGAREDNEAFGGNYELPNARAYCETCAGLANCMFNLRMFSLY
GDSRYIDILERSLYNNVLSGISVTGDMFFYPNRLEASSRGQQRSEWFGCSCCPTNLARFI
PSVPGYAYATGKDAVYVNLFIAGKADISLDRQQISLTQQTEYPWEGNVRLSVDKTQKGDF
CMKIRIPGWAQGRPVPSDLYSYEATSTKKTVIKVNGKPYEYDIDHGYAVIQRKWKAGDTV
EIEFPMEPRIVTANAEVKADRGLIAVERGPIVYCAEFADNGGTLQDLYIPRGASLKVCKT
EGIVNGMRTIVAQGRRCSADAQNGVSESAADVTLIPYMARAHRGAGEMKVWMPTDGKAIM
ENMDYIDKVVIADETSEREHNLQGQNMRSDASLGWRDALDGWISYDMTVDPQKTNEVVLT
YWGSDAGNREFDIMADGTPIGRDRIENCMPYEYYDVRHVIPQDITKGKKKVTIIMKSLPG
KITGGIFGIKTTVKE

Enzyme Prediction     

No EC number prediction in MGYG000002737_00847.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	29	574	1.9e-193	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.12e-165	28	574	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.23e-147	23	656	11	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	7.46e-04	179	373	102	275	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SIP56265.1	0.0	9	795	2	786
AII65963.1	3.05e-267	24	790	32	801
QJR74370.1	4.32e-267	24	790	32	801
QJR65776.1	4.32e-267	24	790	32	801
QJR70038.1	4.32e-267	24	790	32	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.68e-216	21	658	7	629	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	5.37e-140	27	652	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.17e-135	27	652	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.35e-116	8	653	23	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	8.41e-101	28	651	2	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.60e-100	28	651	2	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.077838	0.920587	0.000780	0.000320	0.000229	0.000223

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002737_00847.