CAZyme Information: MGYG000002730_01389

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000002730_01389
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		45777.68	4.7481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002730	1768289	MAG	Netherlands	Europe

• Gene Location: Start: 606; End: 1850 Strand: -

Full Sequence      

MNKPDHFLWGVSTAGHQTDGGDAAADTTFLEHVEPTVFKEPAGDACRSWERWEDDLNCVA
EMGLNAYRFSVEWCRIEQEEGVIDQAALDHYDRLMDGCLARGIQPVLTLCHFTCPHWFAK
RGSWLAPDAVDLFAAHVRRVMELARGRAAAVVTLNEPNLNQLLANGAMPPEAFAFQQVVL
HAAAAKAGVAHYRAGNVQDIDEFDAMDEAMARAHRRAVEVVREVAPGTPVGLSLSVVDDD
WATPAGRAICERKRELCYGKWVDAIQGDDFIGVQNYERMVFGDEGLIAPDPTQPINGMGT
QVEPGSLAGAVLYIHELTGLPVVVTEHGISTEDDHLRCDFIRASLPALAGLVRRGLSVLG
YFHWTLMDNFEWISAFDSRLGLYEVDRRDGTYDRIAKPSARVYADVVRTLNGRM

Enzyme Prediction     

No EC number prediction in MGYG000002730_01389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	409	1.2e-89	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	5.85e-76	4	412	5	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	4.10e-70	4	412	6	452	Glycosyl hydrolase family 1.
PLN02998	PLN02998	1.10e-28	4	408	32	486	beta-glucosidase
PRK13511	PRK13511	2.17e-24	4	409	6	465	6-phospho-beta-galactosidase; Provisional
PRK15014	PRK15014	4.73e-21	4	412	7	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKV55706.1	8.23e-180	4	407	16	419
QYN59796.1	4.39e-165	4	407	6	409
QAY59348.1	1.02e-145	7	408	9	407
AMB57610.1	3.20e-141	2	407	5	407
CQR65630.1	1.29e-140	1	409	4	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.10e-86	4	408	8	410	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	5.67e-80	7	400	36	421	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.47e-51	1	409	9	447	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	7.62e-49	1	409	3	405	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6JFP_A	6.06e-42	4	407	5	438	Crystalstructure of the beta-glucosidase Bgl15 [uncultured bacterium],6JFP_B Crystal structure of the beta-glucosidase Bgl15 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q08638	3.66e-39	4	408	7	440	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B9K7M5	3.47e-38	4	408	5	438	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P12614	1.62e-37	4	404	12	443	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1
Q9H227	3.61e-37	1	408	1	461	Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
Q5RF65	9.51e-37	1	408	1	461	Cytosolic beta-glucosidase OS=Pongo abelii OX=9601 GN=GBA3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988647	0.011320	0.000028	0.000015	0.000009	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002730_01389.