CAZyme Information: MGYG000002721_02384

Basic Information

• Species: CAG-873 sp009775195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp009775195
• CAZyme ID: MGYG000002721_02384
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000002721_31|CGC1	83681.92	5.1523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002721	3174810	MAG	Canada	North America

• Gene Location: Start: 21144; End: 23330 Strand: +

Full Sequence      

MNYLLRRYVLIFAALLCATAAFSQSWIWFPGDMDIWTGNRVNNRRTENGGMWPAFWRNDS
HWQTVEFSKTVDLDHDEEVEIAAEGKYSVKIDKWFMFGMPDKISIPKGRHKIIITVNNLV
SPPAIWVNGPSVKSDETWAVSNYAVSERPDTWYDVDGKPMFASRSARPSQYRLPVSRVFP
VDVSRSGREIFVDFGRESMGYLSLDSVCGDGVVRVWYGESPDEARDKEWAYLKDMVTFTP
DSIIDMQDMTVSRRTTPDYKLANSRAIRYALIEYDEGLDVGTVSLMSEMKDLGDRYRGSF
ECNDTLLNKIWDVSAYTLHLTNREVMIEGVKRDRWMWSGDAIQSYLMNYYVFMDMPVVKR
TIWAMRGKDPVEQHINTILDYTFYWFNSVYDYYLYTGDDDFMKRIYPRMQSLMSFVEGRL
DGNGMVEGQKGDWVFVDWSPGPMSKKGELSFEQMVYLRSLDAMSLCAEIVGNEGDRQKYA
DMADNIRRQLVPRFWNDEKNAFVHTVIDGRQSDEVTRYANMFAVLYGLVDDERSDAIRDN
VLLNDSIMPITTPYMQFYELEALCSLGEHGRVLDEMRSYWGGMLGEGATSFWETYDPSEP
YPQRLGMYGHPYGKSLCHAWGASPLYLLGKYFLGVRPTKPGYKEWVAEPRLGNLKWMRGD
VPTPRGNIHIEMTRKEITVKANNCGEGTLLFSSSKRPRVTGGTIQNLADDSYKVVVPPGA
TVKVSGSF

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	185	678	1.2e-107	0.9603174603174603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.83e-27	298	631	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	6.63e-09	376	541	81	259	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17390	Bac_rhamnosid_C	1.04e-05	634	680	1	48	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	9.48e-05	389	496	108	212	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG3408	GDB1	3.18e-04	377	545	336	513	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95851.1	1.55e-279	6	714	3	720
CBK65632.1	1.79e-278	6	714	3	720
QRQ56933.1	3.59e-278	6	714	3	720
SCV09640.1	3.59e-278	6	714	3	720
ALJ45306.1	3.59e-278	6	714	3	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.17e-261	9	714	3	717	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	2.56e-47	173	673	421	916	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	8.62e-27	186	633	91	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	3.93e-21	294	689	727	1136	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KPL4	1.38e-07	298	728	490	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001452	0.997471	0.000374	0.000269	0.000214	0.000199

TMHMM  Annotations     

start	end
7	29