CAZyme Information: MGYG000002719_01818

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514
• CAZyme ID: MGYG000002719_01818
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		48682.98	7.7892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002719	3080250	MAG	Canada	North America

• Gene Location: Start: 467; End: 1738 Strand: -

Full Sequence      

MDFVSVITTLVWVLTIIVGIHTVYFTVVALFFLKKAPKYEQYEPKNRFAAIIAARNEEDV
IGNLVESLRLQNYPADLLDIIVIPNNCTDRTKEVAQKAGATVVECPHRVKSKGEVLSFIF
DHIFEENDVYDAFCIFDADNVVHPDFMREMNNVLCSGIKIAQGYRDSKNPSDSFISSCYS
IYYWAVNRFYNHARSALGMSAMVNGSGFMVSADVIRSMDGWHTVTMTEDIEFTTQCALRG
YKIGWASEAIIYDEQPLTFMQSWKQRKRWSTGVIQGMETYTGKLLKAGFKNKNICCFDMV
LFYLSPIMQVLFFLLVILAMWLNITYILFYLFPFVRLGMFQRIFLAFNLSYIFAAAMSCI
VVMLAHKKVSGMTKGVFTFWIFIFSWIPINIICLFKRQKTWEEIKHSSDVKITDVTEVTQ
IKV

Enzyme Prediction     

No EC number prediction in MGYG000002719_01818.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	47	271	1e-30	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	7.33e-71	51	232	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	7.25e-38	3	384	14	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.53e-37	51	229	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.23e-24	46	272	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	6.73e-22	137	322	6	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX65217.1	6.78e-135	5	418	10	424
ADO38773.1	5.64e-128	21	415	19	410
ARD65366.1	5.64e-128	21	415	19	410
ALU13522.1	9.13e-127	21	415	19	410
QCT71577.1	9.13e-127	21	415	19	410

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.06e-15	32	305	34	309	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	2.43e-14	44	275	106	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q6G608	1.32e-06	17	272	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q8NUI7	1.32e-06	17	272	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q5HCN1	4.09e-06	17	272	19	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
193	215
310	332
344	366
376	395