CAZyme Information: MGYG000002717_03378

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002717_03378
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		89592.18	5.7136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002717	5602088	MAG	Canada	North America

• Gene Location: Start: 119; End: 2560 Strand: +

Full Sequence      

MKLKYIILALSGLLTFIQLKGADYVKLMKDKKTGVSYYDLNKNGRLDIYENPAFTIQERV
SDLLSQMTLEEKIGQMLTSLGWPMYERQGSVIRLTEQLTKEIEEYHTGSLWGFMRADPWT
QRTLTTGLSPDLAAKASNMLQKFAIEHGRLGIPLFLAEECPHGHMAIGTTVFPTSIGQAS
TWNPGLIQRMGQAIAAEVSVQGAHIGYGPVLDLARDPRWSRVEETYGEDSYLNGVMGAAL
VRGFQNDLGNGKSVIATLKHFAAYGWTEGGHNGGSAHIGSREMEEAIYPPFREAVAAGAL
SVMSSYNEIDGIPCTANYNLLTEVLKRRWLFDGFVVSDLYAIGGLREHGVAATDYEAAVK
AVNAGVDSDLGTTVYAGQLVDAVRAGDVSEIVINDAVSRILCLKFRMGLFDHPFVDEKLP
AQTVASSEHVELAREVARQSMILLKNENALLPLNKDIKTIAVVGPNADNVYNMLGDYTAP
QSEKTVITVLDGIRQKVSANTRIMYAKGCAIRDSSKTGFQEAIEAARQSEVVIMAVGGSS
ARDFSSKYEETGAAKISNTHISDMESGEGYDRSTLELLGKQRELIYEIRKLGKPIVLVLV
KGRPLLLEGVENDVDAIVDAWYPGMQGGNAIADVIFGDYNPAGRLTISVPRSVGQLPVYY
NTKRKGNRSKYIEEEGTPHYPFGYGLSYTSFGYSDMQTEVVETADDCQVSVSVMVRNEGS
CDGDEVVQLYLRDEVASFTTPLKQLRGFQRIHLKVGETKKITFLLDKKSLGIYMQNGEWA
VEPGCFVLMIGRSSEQIVQQKEIKITRKYTFKM

Enzyme Prediction     

No EC number prediction in MGYG000002717_03378.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	146	368	8.1e-69	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	47	802	22	761	beta-glucosidase BglX.
PLN03080	PLN03080	2.12e-102	149	791	78	769	Probable beta-xylosidase; Provisional
COG1472	BglX	8.99e-96	67	497	1	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.62e-75	68	403	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	8.17e-70	441	688	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ44844.1	0.0	1	813	1	814
QLK82234.1	0.0	1	813	1	814
QKH85005.1	0.0	1	813	1	814
QTO27338.1	0.0	1	813	1	814
AUI45336.1	0.0	1	813	1	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.79e-145	130	806	101	783	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5P_A	2.40e-143	51	796	29	756	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5I_A	5.33e-143	55	796	1	724	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5YOT_A	6.68e-143	49	797	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
6R5O_A	2.94e-142	55	796	1	724	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	7.17e-146	47	799	22	759	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	3.61e-144	132	795	46	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	4.32e-144	47	797	22	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	1.06e-129	49	794	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.62e-94	56	798	35	769	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.068861	0.922997	0.007296	0.000282	0.000265	0.000280

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002717_03378.