CAZyme Information: MGYG000002713_01066

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000002713_01066
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	MGYG000002713_68|CGC1	68734.77	5.0201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002713	2668614	MAG	Canada	North America

• Gene Location: Start: 123; End: 1928 Strand: -

Full Sequence      

MYGIINVTILYIRKVTIDMKLQKLKITHTNNADVEFSLKKADGGIDEYAIFMHSDEKIIP
EKICIDFEVPYKEMFTAWNPEARAAVSPYPDWAHRNVCESRAAANAPVQSLIGKNDENRM
TVAVSDSLTPINISFGIHEEDAQVKCQIVFFALPVSALNSYTALIRIDSRHIPFYESLRD
VKLWWNETSGYTDAFVPETARTPMYSTWYSFHQELEPEKLYEQCRISKKLGCDAIIVDDG
WQTADNNHGYAYCGDWELYTGKIPDMRVLTDTIHEIGMKVMLWYSVPFVGIHSKAWNRFK
DKFLDYSEGKKWCCLDPRYTEVRDYLTGIYEKAAIEWGIDGFKLDFIDSFALTESSASEL
KDGMDCIALEDGIKLLLEETMTKLRKINPDICIEFRQRYIGPLMQSYGNMLRVSDCPGDA
LTNRTGMVSLRLITGKTAVHSDMLMWHKTDTAEYAALQLLNILFSVPQISVMLNEIPDSH
FKMVKFYLDFWCKNRDTLLDGEFRPKYYDANYGLIETESSNKIIACAYSVPMLELADTKK
SVVLINASGRDTLFIKGLCGNWNYTVYDCCGNVKEASAVSFDKRAEEFSIPMSGMIVLDR
Q

Enzyme Prediction     

No EC number prediction in MGYG000002713_01066.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.74e-61	200	491	1	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.56e-13	201	346	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	6.10e-09	202	346	292	451	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06597	GH31_transferase_CtsY	8.14e-06	232	345	40	164	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	9.53e-06	227	345	67	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41069.1	9.40e-177	31	598	20	588
QMV40951.1	8.86e-173	36	601	21	588
ASA19679.1	1.15e-172	35	598	27	591
AIQ18885.1	2.12e-167	37	598	25	589
CQR57728.1	4.24e-167	37	598	25	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHU_A	1.71e-08	109	345	272	492	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	5.15e-08	109	343	272	490	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR5	5.53e-07	231	347	339	465	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002713_01066.