CAZyme Information: MGYG000002711_02767

Basic Information

• Species: UMGS856 sp900546265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856; UMGS856 sp900546265
• CAZyme ID: MGYG000002711_02767
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		67815.48	5.8375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002711	3636319	MAG	Canada	North America

• Gene Location: Start: 1257; End: 3059 Strand: +

Full Sequence      

MPLLPAPKEMHTVPGVSPARGFTATNAGPFAEERLALRSLGALSVQADGLYYAVIAAQAD
ATLPDLPAVLRRPGREEGFFLSADEGLVCVLSAHPRGVLYGLHAYEQTLADDGSFCGTVI
DYPDTAFRAFHMDMRYGFPSVSRMLAILEELSAARFNTFLLEYENRFPFEAYPDIADPAH
FTPADLRRIQERAAALHIELIPLQQTIGHLEYMLKLPRYHHLREMREFPETPLPYSFGPT
GFKHYNHIDEICASSDEACSVVETLLDEVMAAHPASRYVHLGCDEAWNLLSCPDCLARYG
ENGKNRLYLGHINRLAARALAAGKTPIVWDDMLRSFSDEELELLDKRVVVMIWLYYESNY
ALAVKLARRFKQAGFTVLGAAAAKCGEGPEPQYLDMPWYELRLGNVDMWGRVCAEEGLDG
FCMTVWSNYSGTIAPPHPFFDTVWYPVLFAAEKLWNRQAVRDGFDTRFAAAFFGVAEEAL
FHGPTADRYARIERVSRLAKRHRYEAEVLRVMELTSVYRLKALTIGRELYKLRMPVTDAE
KTIVRNRAAEVAALRELLKPQVRRIVETHYTKDDADVFVRSRFDADEALFRAFLDGKDES

Enzyme Prediction     

No EC number prediction in MGYG000002711_02767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	126	457	2.4e-41	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	4.23e-62	127	429	1	279	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	4.38e-25	128	455	2	302	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	5.95e-21	126	455	2	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
cd06563	GH20_chitobiase-like	7.24e-17	126	398	2	271	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	2.42e-16	157	455	55	324	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98633.1	3.34e-148	1	593	1	597
QUL55868.1	1.00e-77	74	583	108	602
QNK57592.1	2.22e-77	75	583	87	582
BCU82545.1	7.46e-75	72	596	74	592
AWV35100.1	8.94e-75	74	583	87	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CBN_A	9.13e-07	4	332	14	360	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3U4H6	9.13e-33	128	429	10	301	Hexosaminidase D OS=Mus musculus OX=10090 GN=Hexd PE=1 SV=1
A6QNR0	1.09e-32	128	429	2	293	Hexosaminidase D OS=Bos taurus OX=9913 GN=HEXD PE=2 SV=2
Q8WVB3	4.75e-31	128	429	10	301	Hexosaminidase D OS=Homo sapiens OX=9606 GN=HEXD PE=1 SV=3
B2UQG6	5.06e-06	2	332	25	379	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000007	0.000057	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002711_02767.