CAZyme Information: MGYG000002699_00331

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588
• CAZyme ID: MGYG000002699_00331
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	MGYG000002699_4|CGC1	95672.15	6.0448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002699	3362623	MAG	Canada	North America

• Gene Location: Start: 13243; End: 15750 Strand: -

Full Sequence      

MEQIFLQEGWRLREEPLSMQRESVGAVLAQEQGWMDCSLPCDVSMALMAHGRIADPAVAM
HCYENEWIERRSWWFVREFSWAEAARYDAVELVFPSLDCHADVFLNGAYLGHQASAHYPF
RREVSRHLRPGVNRIVVRLTVGLEHVSDGDLAQIDRAVCTERGNGRTDRSDKRRAFLRKP
QYVFGWDWSPRIATCGIMEVAYLELHRKVAVRSLHIATQKLADGHAWLHGEIVVENLDML
GTLDADARLSLCIEGKTICAIEWSDQWLASGIQHLPFEARIPHPCLWWPNGYGEQPLYEA
KCTVSVADEVVAERSESFGIRTVELDTSRDEAGWRRFALRINGREIFCKGANWIPADAIY
ARVDDARFVTLLREAKEANFNMLRVWGGGLYNREIFYRLCDELGILLWHDFMFGCACYPD
HLKAFRLECEREMEFQTRRLRNHPCMALFCGNNENHQIFDWQANPGWGIHPGLDKQYGLL
LANRCAREAVWRNCPEIPYWNSSPYGGARPGEEDEGDVHYWSQCMMNPDMQKRIEPREYE
RVHARFVSEYGYPGPTCLATMREYLGQEAIDRNSEAWKLHTNTFEKDTVAAGIAKHYGDP
EGLSLEEYILYAGMVQSIMLEESLETLRAKLFCAGSLFWMYNDCWGEVGWSIVDYALRRK
IAYYGVRRAFAPVRLILRKVGEMAIIVGCNDAPEPTFLEGMLGYVALDGADARQRRVRFE
IPAGRSIVLREALPQYDICRGVYAFLPDAPEADAAVLRRADIRQMKIAGKAQIENCQAVG
EDLAVIVRASRYTHGVYFAGDMPCSEEYFDLLPGQRKRVILYGCAGQTPVLRWVR

Enzyme Prediction     

No EC number prediction in MGYG000002699_00331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	675	1e-81	0.6103723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.98e-64	1	715	10	673	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.06e-07	209	321	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	1.56e-06	30	454	30	417	beta-D-glucuronidase; Provisional
PHA03231	PHA03231	0.005	161	195	253	288	glycoprotein BALF4; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97186.1	2.08e-280	1	835	1	836
QMW77011.1	1.66e-277	1	823	1	826
QBE99829.1	1.66e-277	1	823	1	826
QIB55134.1	1.66e-277	1	823	1	826
BBI35730.1	4.57e-250	4	822	3	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.14e-116	30	731	39	714	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.66e-96	34	821	25	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.73e-96	34	821	27	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.76e-96	34	821	27	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.55e-96	34	821	25	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	2.99e-78	38	679	31	662	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A2QYN2	7.98e-78	32	679	24	662	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
I2C092	1.32e-77	40	675	32	662	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q0CCA0	7.42e-77	32	833	24	838	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	1.85e-75	32	679	24	662	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002699_00331.