CAZyme Information: MGYG000002684_01832

Basic Information

• Species: UBA3818 sp900557155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA3818; UBA3818 sp900557155
• CAZyme ID: MGYG000002684_01832
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		32667.7	4.3122

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002684	2007927	MAG	Canada	North America

• Gene Location: Start: 4696; End: 5538 Strand: -

Full Sequence      

MCGKRIKQPVALAVLFVLMFIGGCFFVKANQAKEFEKNDYRVFLNADASSLERFKMYETI
VIDAQYFTKRDIELLHQNGTVVYTYLNIGSIENFREYYTTYAELAIGEYEHWEEEEWVDV
ANPDWQKFIGQLSQELYEKGVDGFFIDNCDVYDYAPHESIFEGITAILQNMMTFGKAVII
NGGDTYVAEYRERYGAIDQIMTGVNQESVWSSIDFDSGTFHEQTSEAREYFSKYVEACKA
DGVEVYLLEYTTNQKLIQKIKEYCKEQDFHFYISSSLELR

Enzyme Prediction     

No EC number prediction in MGYG000002684_01832.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	59	275	7.9e-57	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	6.94e-11	28	277	57	301	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
COG2342	COG2342	4.38e-09	15	250	2	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	1.13e-07	61	153	21	113	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
cd06592	GH31_NET37	0.001	118	191	120	191	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	2.97e-104	4	279	10	282
VCV23723.1	5.98e-104	4	279	10	282
CBL11057.1	5.98e-104	4	279	10	282
AOZ95737.1	3.35e-89	4	280	8	286
QHI71547.1	5.57e-82	14	279	6	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000075	0.000066	0.999889	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	27