CAZyme Information: MGYG000002683_00160

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; RUG12999; RUG12999
• CAZyme ID: MGYG000002683_00160
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713	MGYG000002683_4|CGC1	80743.53	4.9045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002683	3225682	MAG	Canada	North America

• Gene Location: Start: 30697; End: 32838 Strand: +

Full Sequence      

MAYKKAEFGKAVWIAPSEECISPMIYSSLPSANGETVKITIGSLGMFELFINGRKAGNDL
FLPLNTDFHERDKLIFNDIPFKESLGHRLYCPVYDISEYLDRETNTICFVMGGGWYEMRG
CDYDYGKVQICWKAEYINKNEITRTACSDGGETWKPGYITEYSLTLGETHDYSSYGNASA
KPVEIRKAPETSLYIQDCPPDRVIRRIMPKKIGKNIYDVGEIISGYPILKGLSAKITVRY
GELLNEDGTLCEENVYNQHTTYINGENRMLYPRFTWLCFRYFEVIGEAEVTECDVIHSDV
AVTSEFECDVEVLNWLAKAYVRTQLDNMHCGIPSDCPHTERRGYTGDGQLTCGAALMQLD
ALKFYKKWIYDIADCQDRKTGHIQYTAPFTPSGGGPGGWGCAVVNVPYEYYRACGDTEIL
RDMYPHMIKWLEFMENHSENELVTSDVENAWCLGDWCAPAQDSLNKFGGMIIPEPFVNTY
FYIKSMLQIIEIGNILNIHENDDMLSERIEKKKSALIRNYFDESTGNFANDEQGSNAYAV
DLGIGDERTLKNTVEKYNRNGYYDTGIFGTDILTRILFKKGYAHTAVSLLTSEKDISFYS
QMKGGATTLKEYWNGVRSQCHPMFGAVTRYLYEYILGIRQAANSVAYENVIIEPVCRDVI
KTAKGGITTVKGRISVEYSESCIKVEIPDGVNTVLRSDGKEIRLNTGITTIVY

Enzyme Prediction     

No EC number prediction in MGYG000002683_00160.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	213	695	1.7e-109	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.70e-64	303	635	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.51e-17	41	205	10	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.79e-07	213	302	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	2.69e-176	8	680	3	687
BCJ98018.1	6.92e-106	13	688	127	849
QOY86540.1	1.82e-94	35	679	165	820
QMW80401.1	2.89e-89	10	681	124	813
QIB56822.1	2.89e-89	10	681	124	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.15e-58	22	693	176	892	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.22e-42	6	680	285	973	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.75e-43	35	688	198	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	6.55e-42	6	680	285	973	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.07e-36	38	678	191	855	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002683_00160.