CAZyme Information: MGYG000002675_01672

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002675_01672
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	MGYG000002675_12|CGC1	52084.62	6.2534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002675	2270055	MAG	Canada	North America

• Gene Location: Start: 27078; End: 28457 Strand: +

Full Sequence      

MTKKKYLCPAPARENRGHFTQQAMKRYAILILALCSAWSASTAQTPQMRRSEFVTFDTRR
DALAGDRSKTQRYFAVEPASEGSVEAGELYAQRFDIPASWNDYNTYLHLENVGSAYTLAI
NGQTVAEVEDDRTPADFLISPWLQQGSNTLSVILRPSRHPELQEGIPMPQRPRFDGSYVF
AQRKLHVYDFKAAIVPDSTEKYGIFRMDVIAANDFNYDETIAIGYDIYSPEGKLIDYGVR
EMTLAGRSRDTLHVKADIYGAYTHKWGGNRGEAPLYPVMLYVKRNGMIYEYIPFKAGFGV
SELENGRIVRFGKPIDIVRQRYNAAADRTTTAREIAAMKKQGVNTLIPDFPQPEWFYDEC
DRAGIYVIDRANINAPHNAGDRSVGGTPSNDPALLDEYIDRIDAMYFRVNNHPCVIGFML
GGESGNGYNMYKAYEHLKSLEERRPVIYENSFGEWNSDM

Enzyme Prediction     

No EC number prediction in MGYG000002675_01672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	90	451	2.6e-39	0.42154255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	7.88e-29	89	452	112	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.14e-28	73	450	68	433	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	5.01e-27	90	449	124	488	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	1.03e-18	302	450	2	162	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	2.68e-08	90	152	69	131	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL15391.1	3.25e-155	24	458	1	431
BBL03281.1	3.25e-155	24	458	1	431
BBL07145.1	8.30e-155	47	459	35	445
AFL78621.1	1.05e-154	47	459	42	452
BBL00145.1	3.06e-149	22	459	18	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	1.06e-35	90	459	126	496	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	2.03e-30	78	459	121	500	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SD0_A	1.09e-25	89	451	113	469	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.09e-25	89	451	112	468	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6CVM_A	1.95e-24	90	449	122	486	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	6.90e-33	90	452	137	510	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P23989	7.22e-27	90	449	124	484	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1
A8GGN3	7.52e-26	90	449	125	487	Beta-galactosidase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lacZ PE=3 SV=1
A1SWB8	7.54e-26	74	449	106	486	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
Q9K9C6	1.34e-25	90	452	124	489	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.108593	0.749528	0.140273	0.000751	0.000478	0.000359

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002675_01672.