CAZyme Information: MGYG000002675_01602

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002675_01602
• CAZy Family: GT2
• CAZyme Description: Dodecaprenyl-phosphate galacturonate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000002675_10|CGC2	27664.72	8.6753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002675	2270055	MAG	Canada	North America

• Gene Location: Start: 43757; End: 44488 Strand: -

Full Sequence      

MNKTAEYEFTIIVPVYNEEDNISELERAFTAYLPRASKRTCVLFVNDGSNDASGERIEEV
CRRNKDFYYISFARNAGLSAAIKAGIDCAQSPLVGYIDADLQTTPEDFELLLPHSGDNAL
CTGIRAARRDSVFKLIQSKIANGFRRMMTGDGATDTGCPLKVMHTDAAKRIPFFKGMHRF
LPALILLQEGARYYETPVRHFPRMAGKSKFHLWNRLVSPFMDCFAYRWMKKRYINYNVAE
GNI

Enzyme Prediction     

No EC number prediction in MGYG000002675_01602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	139	1.1e-22	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	1.44e-43	11	187	1	182	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd04187	DPM1_like_bac	5.34e-42	11	185	1	176	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
133031	cd04188	7.55e-26	11	199	1	203	DPG_synthase DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
COG0463	WcaA	1.42e-21	8	222	4	215	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	1.22e-19	10	181	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42978.1	2.40e-120	1	242	10	251
QCQ49524.1	4.84e-120	1	243	1	242
QTO25705.1	4.84e-120	1	243	1	242
QCQ56254.1	4.84e-120	1	243	1	242
QCQ38477.1	4.84e-120	1	243	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EKE_A	1.63e-13	5	214	24	234	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	1.63e-13	5	214	24	234	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ5	2.29e-24	3	222	5	223	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnC PE=3 SV=1
Q1MJ95	3.72e-22	8	222	19	237	Dodecaprenyl-phosphate galacturonate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=rgtE PE=1 SV=1
B5R271	3.14e-21	10	222	11	223	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=arnC PE=3 SV=1
B5RCC3	3.14e-21	10	222	11	223	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=arnC PE=3 SV=1
B5FNT8	3.14e-21	10	222	11	223	Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=arnC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002675_01602.