CAZyme Information: MGYG000002661_00877

Basic Information

• Species: Ruminiclostridium_E sp900556525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp900556525
• CAZyme ID: MGYG000002661_00877
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000002661_50|CGC1	50617.99	4.7073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002661	2289773	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 3003; End: 4352 Strand: -

Full Sequence      

MAYINGKWRQGLRLEPPQGWLNDPNGLCYFDGYYHVYFQYAPDNADGSGKKCWGHYRSPD
MLKWEFTGTVLFPDTPDDKDGVYSGSAVVCGDILHIFYTGNVKEDGDHDYITSGRGANII
HVTSADGVTMSAKKTVLRNSDYPDFCSCHVRDPKVWLENGVWRMVLGARTLDNKGCVLFY
SSRDLENWRYDGTVSTPEFGYMWECPDLLDFDGHGYLSVSPQGLEHGDMKYQNVYQSGYF
RCENELKNFTEWDIGFDFYAPQTFTAPDGRRILIGWLGIGDIPYSNPTVPLGYQHCLTVP
REITVDSDGSLLQNPIRELLSLRGGKMSISDGERVETLLPFDLTAEVIGSFEITLCGALT
MSWDGNIFELRFTNEKFGGGRTVRKVALGKCSDIRIIADKSSVEIYLDDGKTVLSSRMYP
ESDKVGLTVKRLNAELFTLKEMEVSYLGE

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	14	315	3.1e-87	0.9931740614334471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	4.91e-150	19	306	1	288	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.29e-133	7	420	12	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	7.36e-126	3	431	23	470	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.19e-104	14	315	2	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.84e-96	14	410	2	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM70237.1	2.29e-203	8	449	5	442
CCO04388.1	6.12e-182	5	439	15	456
BCN29305.1	1.55e-147	5	443	25	475
CCG05878.1	2.54e-143	9	439	29	463
QCU01937.1	1.00e-142	14	440	34	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	4.69e-72	4	436	21	475	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	6.29e-67	2	440	42	483	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	9.38e-66	2	440	42	483	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
3PIG_A	4.82e-63	2	440	33	503	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	9.62e-58	2	440	33	503	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.28e-95	9	420	29	454	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P40714	2.22e-81	12	429	28	459	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
Q05936	6.91e-81	7	427	32	471	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P16553	1.84e-79	8	429	23	458	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P27217	4.29e-78	14	420	32	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999383	0.000547	0.000053	0.000003	0.000001	0.000019

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002661_00877.