CAZyme Information: MGYG000002658_00336

Basic Information

• Species: Oribacterium sp900772695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sp900772695
• CAZyme ID: MGYG000002658_00336
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	MGYG000002658_13|CGC1	82782.54	5.1831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002658	2287878	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 8124; End: 10307 Strand: +

Full Sequence      

MSIIFNEEKKAFLLNTKNTSYQFRVAEFGFLEHLYYGRRVEEAVDYIPVRLRHGFEANPH
EMKQDRTLCLDVLEQEYPGFGVSDFKTSACSIIHADGSNCIDFRYVSHRIYPGKYSIDGM
PSLRNKGGDWMTLEVVLQDIATKVEVTLFYGVLESCDVITRHAVIRNLEDTAITLHAAHS
TCLSFPTDQMDQIDFYGSWGHERNAQRTPVRHGKTVVDSIRGISSHYYNPTIVLCDHEAT
ETAGDCYGVALVYSGNFQITVEVNDFKQTRVVAGIHPDTFYWKLNPGDAFATPEAVMSFS
AAGLTGLSHHYHDVVRHFLIPGQFEDQRCPVLLNNWEATMIDFDEEQLMQIASAGKELGV
EMFVMDDGWFGRRTNEFRGLGDWQCNLEKLPSGIAGFAKRIHGLGLKFGIWIEPEMVSED
SRLYEEHPDWCIAIPGRKPTWQRYQLILDYSRDEVVDYMFEQIYDEFKDADIDYIKWDMN
RSMTDRFSQALPADRQGELCHRYVLGFYKLMEKLTSTFPQIRFEGCCGGGGRFDMGVLYY
APQIWCSDDTDAIERISIQHGTSFFYPPSVMGAHVSVCPNQQTGRTVSINTRAALAYYGT
FGYELDPNELTDDEKEAVKHQIQYYQAHALTSAFGRYYRLTDVGHEFVAFMSVAEDQKSA
VFSFVQLRSGANKGIIYIRLRGLDENAVYRIPELGLELTGASLMYAGLPMPVIKADNSAK
TFTLLQK

Enzyme Prediction     

No EC number prediction in MGYG000002658_00336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	12	709	2.2e-256	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	12	716	4	673	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	1.22e-177	290	635	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	6.83e-136	328	627	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	3.68e-107	29	285	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	5.23e-21	648	724	2	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU01183.1	0.0	1	727	1	729
ADL06712.1	0.0	1	725	1	727
QRV19220.1	0.0	1	725	1	727
BCK01162.1	1.60e-247	1	712	1	712
QUO31118.1	1.11e-242	1	724	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	3.07e-236	1	726	1	719	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	1.71e-219	1	716	1	716	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	4.86e-219	1	716	1	716	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	1.57e-217	1	716	1	716	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	2.22e-217	1	716	1	716	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	1.90e-232	1	726	1	719	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	2.66e-218	1	716	1	716	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	1.19e-195	3	722	6	726	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.80e-189	1	722	1	725	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P27756	4.80e-159	53	727	51	720	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002658_00336.