CAZyme Information: MGYG000002653_01648

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_01648
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000002653_28|CGC1	86392.82	7.9955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 15000; End: 17270 Strand: +

Full Sequence      

MTKRHILFLLFAITLRVAAQSPTCFGEAQWIGAITRQQAKIPEGRHYTGGILKQTRALWN
AADTLSRRSIYIARNFQLKKRVVHATVQIAGLGCYKLSINRRTVGDAEFSPAWSDYDKTV
FYNTYEVDTCLQRGMNTVQVLLGNGFYNEQGGRYHKLKVSFGPPTLLLALHITYHDGSKE
TIVSDTAWQWSLSPITFNSLYGGEDYDARISSTTWHPVVVQQSPKGTLRPQLAYPVKVME
HYEVAQTLRRDSILVFDMGQNLAGFPEITVKGKRGQHIKITPAETLTDDLRCNQKQTGRP
HYYTYTLSGKGTETWHPVFSYYGFRYLQVEGDIETLRHIRSCFVYNAAPRISSFECSNPR
INATHRIIDRAIRSNWQAVWTDCPHREKLGWLEQDWLNGEALLYNYDCKTMIQQTMQNMA
DAQHPNGAMPETAPEYTVFTGDWAKPFLESPEWGGALIALPFLYQQYYGDDSLIRQYYKP
MKRYVDYLASQDSCYILRMGLGDWYDYGPWRAGFARNTPMPLVSTAHYYWWNHLMGEARA
DSIREAFNREFYNPQTHRYASGSQCAQAIALCMNLVPDGDRQAVLDQLVADIHQHGDRLT
TGDIGNRYLFKALIDGGQRELLYRMLNHDEVPGYGYQIKQGMTTLTEQWNPKHGASMNHF
MMAHIENFLIPDLLGIQRRGNNLLIAPHPVGDIHWCKGSTASAHGTVSVDWRIKGHTFYI
DIMIPQGDHATLQLPYGGSEQLEGGSHHRSQQIPQH

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	250	734	8.5e-134	0.9900793650793651
CBM67	65	216	6.8e-25	0.8011363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.14e-96	349	669	1	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.35e-55	80	240	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.48e-27	250	345	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.48e-09	684	750	13	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY43512.1	1.67e-294	21	735	128	901
QNT67887.1	2.86e-294	27	712	20	775
QQY37483.1	9.54e-294	21	735	128	901
ABR40381.1	9.54e-294	21	735	128	901
QUT58489.1	7.72e-293	21	735	128	901

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.53e-99	74	735	181	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	7.32e-76	59	735	292	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.08e-70	66	746	128	858	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.00e-87	25	742	146	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.51e-75	59	735	292	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	9.55e-75	27	743	150	887	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.12e-61	27	735	147	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000317	0.998960	0.000258	0.000148	0.000142	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_01648.