CAZyme Information: MGYG000002653_00248

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_00248
• CAZy Family: GH5
• CAZyme Description: Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MGYG000002653_3|CGC3	57054.21	5.9617

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 58021; End: 59583 Strand: +

Full Sequence      

MKRLTNYLMKVGMCLLGSLAFVACGDDDPDDGPAVEGLTVTPTSLSFTKDGGQKSISARA
GQDVTASSDAAWCVVTVGEKTPTLKVTPINVAVEANTTTEQRTATITVKAGAESKTVSVT
QEKGEAKPDPTPDPSGNIKYDAKQVAKLMYPGWNLGNTMEAGDNKNSWKSVGVSTETAWQ
KTKTTKELINFIKAQGFKSVRIPCAWVMGHITDTNNCTIDPQWMARVKEIVSYCVDADLY
VVLNQHWDGGWLEHDGFTANAAVALKKQQLTKIWTQIAEAFKDYDDHVIFAGLNEPGVGG
AYEDNGKNIADDKLASRLAEYEQTFIDAVRATGGNNEYRVLVVQGPETNIDKTVKNNYVS
KLTDKHTGRLMMEVHFYDPYQFTMMNKDESWGKMWYYWGKGNTGSDANRNANSNYTENYV
KNQMAKLKTAFVNNGIPVIIGEFGANQRFAIGQDPIHDASIKAWYAAVTSYAINNGCIPY
AWDTNSGNGMSIIDRSNIKVLNTNMMTGVTEGVAAAKWPY

Enzyme Prediction     

No EC number prediction in MGYG000002653_00248.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	176	485	8.5e-93	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.56e-49	172	489	12	272	Cellulase (glycosyl hydrolase family 5).
cd14948	BACON	3.14e-20	38	122	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
COG2730	BglC	6.16e-17	123	502	33	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam19190	BACON_2	2.09e-12	38	122	2	89	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
pfam13004	BACON	1.51e-10	63	122	2	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB44000.1	5.42e-134	35	520	40	516
QNT65311.1	4.43e-115	126	520	19	430
VEH16026.1	7.77e-112	1	517	31	606
QUT37093.1	2.23e-100	34	520	128	593
QUT65987.1	1.74e-99	34	520	128	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W8A_A	2.28e-111	141	520	2	378	Crystalstructure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W8B_A Crystal structure of XEG5B, a GH5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with XXLG [uncultured bacterium]
5OYC_A	2.11e-79	130	515	33	395	GH5endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYC_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYD_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_A GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],5OYE_B GH5 endo-xyloglucanase from Cellvibrio japonicus [Cellvibrio japonicus Ueda107]
6HA9_A	1.64e-78	130	515	33	395	Structureof an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HA9_B Structure of an endo-Xyloglucanase from Cellvibrio japonicus complexed with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_A Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107],6HAA_B Structure of a covalent complex of endo-Xyloglucanase from Cellvibrio japonicus after reacting with XXXG(2F)-beta-DNP [Cellvibrio japonicus Ueda107]
3ZMR_A	1.46e-58	44	513	16	466	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]
2JEP_A	1.24e-56	141	513	34	394	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT7	1.38e-59	13	513	22	501	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
P23660	2.72e-50	135	511	19	361	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
O08342	4.71e-49	142	513	40	399	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P54937	7.08e-48	142	512	39	377	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28623	1.81e-47	142	516	43	375	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000071	0.999991	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_00248.