CAZyme Information: MGYG000002653_00222

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_00222
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000002653_3|CGC1	78973.29	4.8991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 11549; End: 13588 Strand: -

Full Sequence      

MAMTSNPMPHATWIWYPGDFEVWLGNQFNNRRTERGAMFPPFWKQDSHWPTVEFSTTVEL
AESETIHIKAEGPFNFMFDGKLQFGMPDEFLIPAGAHRLNFKVWNQSTPPALFIKGMTIQ
SNSSWLATYEDKIWIDENGVAHGSGIYVPAAQWNFDCMDTPPSAYRLPTLRQEPVAQESI
GEGMLYDFGRETFGYVRLSGLVGVAHIYYGESREEALDKDHCETLDVVSTSQKLSSKAFR
YVYVETADNSHYDSLSMDYEYAPYDESHSGTFACSDKLLNKIWEVGAYTMDLTTREFFLD
GIKRDRWTWSGDAIQSYLMNYYLRFDTECVKRTIRQLRGKDPVTAHINTIMDYTFYWFKS
ILDYYQYTGDLTFISEMYPKMCTLMDYVLERTNSDGLVEGKADDWIFVDWVDFPMHKRGV
LAFEQILFYKALMTMHTCATLLHQTDPYQQLAENVICKTRQLLWNDDRQAWEHAIEEGEI
NHQITKFPNIFAILYDIVDDATKRNIVDSVMENNKVDPITTPYMRFYELEALCMMGRQTQ
VLQEIRNYWGGMLREGATSFWEKYIPSEQGTEHLAMYGRPYGKSLCHAWGASPVYLLGRY
FLGIQPTQPGYATWEARPNLADLEWMEGRVPTPNGIIHIRMERHYVCIRSDEGRGRLYLG
NRCFDIEPNTDYHIPITSV

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	183	643	5.8e-104	0.9424603174603174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.32e-21	267	600	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.66e-05	348	468	81	215	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam04685	DUF608	8.49e-04	364	465	111	212	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
pfam17390	Bac_rhamnosid_C	0.001	603	643	1	42	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.005	348	466	336	460	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48848.1	9.28e-287	12	657	22	677
QUT45325.1	1.52e-285	12	657	22	677
QCD40912.1	1.02e-284	12	672	22	705
QUT83668.1	1.79e-280	12	671	22	709
QJR72185.1	1.79e-280	12	671	22	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.21e-263	12	662	19	697	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.03e-47	119	635	377	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	5.18e-29	171	602	74	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_00222.