CAZyme Information: MGYG000002643_02292

Basic Information

• Species: Turicimonas sp900542195
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Turicimonas; Turicimonas sp900542195
• CAZyme ID: MGYG000002643_02292
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217	MGYG000002643_53|CGC1	22969.03	9.0537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002643	2740903	MAG	China	Asia

• Gene Location: Start: 6426; End: 7079 Strand: +

Full Sequence      

MPNESSTGFSLRQFTKILAGGLILVASASAAADDFELLAKRCAPTVAVDTLRALVKTESD
FNPYAIGVVGGSVVQPKAFHEAMSTIAKLELSGANYSVGLAQINKKNFSKYGLDAAQALD
ACTNLKAASKILGACYAKAQREGARGQQALHDALSCYYSGNFKTGYDHGYVNKVRTSAGL
QAQVPSITAPEQKNLPEENTSRPLISSSSQQTRGLIF

Enzyme Prediction     

No EC number prediction in MGYG000002643_02292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	36	181	7.6e-17	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	2.40e-71	38	179	1	143	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK13864	PRK13864	3.92e-31	35	203	30	196	type IV secretion system lytic transglycosylase VirB1; Provisional
cd13400	LT_IagB-like	1.04e-08	46	175	3	104	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.06e-05	42	132	6	74	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.74e-05	51	175	4	89	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ97220.1	6.86e-146	1	217	1	217
ANU66069.2	1.18e-145	1	217	16	232
AYY56804.1	4.64e-46	26	183	34	192
QMI47823.1	1.20e-45	26	183	31	189
AFJ89297.1	1.20e-45	26	183	31	189

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C398	1.03e-38	35	197	4	172	Type IV secretion system protein virB1 OS=Brucella abortus biovar 1 (strain 9-941) OX=262698 GN=virB1 PE=3 SV=1
Q2YIT5	1.03e-38	35	197	4	172	Type IV secretion system protein virB1 OS=Brucella abortus (strain 2308) OX=359391 GN=virB1 PE=3 SV=1
Q8YDZ5	1.03e-38	35	197	4	172	Type IV secretion system protein virB1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) OX=224914 GN=virB1 PE=3 SV=1
Q9RPY4	2.90e-38	35	201	4	191	Type IV secretion system protein virB1 OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=virB1 PE=2 SV=1
P0A3V6	1.02e-22	34	200	29	196	Protein virB1 OS=Rhizobium radiobacter OX=358 GN=virB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011077	0.986405	0.000453	0.001343	0.000377	0.000308

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002643_02292.