CAZyme Information: MGYG000002633_01166

Basic Information

• Species: TF01-11 sp003149875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp003149875
• CAZyme ID: MGYG000002633_01166
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000002633_16|CGC1	40217.44	10.6053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002633	2903436	MAG	China	Asia

• Gene Location: Start: 30671; End: 31747 Strand: +

Full Sequence      

MKRTYKEKRKNKHIIAVIGLIFAMCIGSGMFGMSGTAATASQMNAKTPLARHGRLSVKGV
DLVDQSQKKFQLRGVSTHGINWDVGSPYVNEAAFRTLRDDWGVNAIRLAMYTSEYNGYCS
GGDKKALRTKVEEGVQYATKLGMYVIIDWHILSDGNPKQHIKEAKRFFATMAAKYKKQKN
VLYEICNEPNGCSWKTIRSYAQSVTKVIRKKDAKAIVIVGTPTWSQLGSDGTHVEVADSP
LKNVKNVMYSLHFYANEWSHNKYLPAKLDLARKKGIPVIVTEFGMTAASGNGAISTSSTS
RWLTRLDKRNVSYFCWSLSNKNESSALLRPGCKKTGAWTKKDLSKTGQYIRKKYRQRR

Enzyme Prediction     

No EC number prediction in MGYG000002633_01166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	66	314	1.4e-86	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.09e-65	63	322	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.20e-11	100	308	84	343	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	0.004	57	150	40	125	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83458.1	4.09e-178	9	358	4	351
QNL99979.1	1.14e-115	36	357	26	341
QNM00780.1	6.33e-101	47	352	213	510
AFA47670.1	2.96e-100	46	350	196	494
CBK83877.1	7.47e-100	28	351	203	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZT_A	4.17e-93	40	351	22	321	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
6GJF_A	5.46e-93	44	355	2	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	1.11e-89	46	353	3	301	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	2.10e-87	46	353	3	302	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	1.17e-77	52	356	6	299	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	4.35e-92	21	351	7	326	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	6.85e-91	21	355	7	330	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	1.52e-89	21	351	7	326	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
Q59394	3.98e-82	35	355	22	329	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1
Q47096	1.03e-81	35	355	22	329	Endoglucanase 5 OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=celV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.020747	0.938634	0.038798	0.001054	0.000402	0.000350

TMHMM  Annotations     

start	end
13	35