CAZyme Information: MGYG000002633_00878

Basic Information

• Species: TF01-11 sp003149875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp003149875
• CAZyme ID: MGYG000002633_00878
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000002633_11|CGC1	61733.1	5.026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002633	2903436	MAG	China	Asia

• Gene Location: Start: 8109; End: 9686 Strand: -

Full Sequence      

MAVPGCWESHPLFADYRGEGIYRKRFQAEGDIQIECKGVSHTAVLVLDGKQIAQHYNAYT
PFLVVVKDLAKGEHLLEIKVDNRFHENSALHLPNDYMSYGGISRGVMVEQLQSAYFEYAH
VKTIRKNDRWFINLKAAIFVLKKERLRDKKVIAKVTIDNQTFEWNIRIDEKDNYELNTVL
EMEDVLEWNPESPNLYQMVLQLFVEDDIIDDLIERFGFREVRISENNILLNGKKLRIKGV
CRHEDHPDYGCALPYGAIYHDLVLIQQMGANSIRTVHYPNDEIFLDLCDEMGILIWEENH
ARGIEEEQMKHPLFEMQAENVIKEMIAAHYNHPSIFIWGILNECASETLFGRECYKKQFE
LIRQMDDTRPCTFASCKFFQDICFDLPDVVSCNIYPRWYVDQSTETYMTEIFDWIEQDKQ
GKDKPFLVSEIGAGAIYGYHNQHQGKWTEEYQMKALNEQISTCLQYDGCSGVYIWQFCDN
RVSKEWFASRPREMNNKGIVDEYRREKMSYAKIKEIYGQYGNYFD

Enzyme Prediction     

No EC number prediction in MGYG000002633_00878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	517	1.8e-89	0.5718085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	4.51e-63	39	515	91	590	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.27e-53	2	490	46	540	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	4.16e-41	221	479	1	244	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.54e-31	131	369	235	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.45e-28	167	344	279	463	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYJ45883.1	1.30e-231	1	525	37	559
SET92908.1	4.83e-226	1	523	35	555
BBF44889.1	3.53e-225	1	517	37	551
QOV20934.1	1.65e-212	1	523	37	559
QBE97736.1	4.15e-202	3	523	38	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NCW_A	1.83e-216	3	525	39	560	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
6XXW_A	7.53e-49	15	525	69	597	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6ED1_A	1.68e-47	3	510	58	592	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6D89_A	6.40e-47	1	517	81	587	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	7.13e-47	1	517	89	595	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	5.84e-39	3	519	84	630	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.95e-38	15	370	53	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P12265	1.69e-37	16	522	101	627	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
P26257	4.75e-37	32	516	73	545	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
P05804	8.60e-36	1	507	45	578	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002633_00878.