CAZyme Information: MGYG000002628_01728

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-81
• CAZyme ID: MGYG000002628_01728
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1042	MGYG000002628_30|CGC1	119665.96	5.7046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002628	2607866	MAG	China	Asia

• Gene Location: Start: 28458; End: 31586 Strand: -

Full Sequence      

MRQIEFVKYNRTRDRKFQLKTEIIRTGEILSVEKTALDVLGAAHIRSFRDKYEKIKDLNP
RIRFLEPVFSNNGMTVSFPYLEGETIGDRLGSEIHMGEVPYGALREAMALVFPEDFGKDP
APVENFHPSEEFISVFGPVADMKDRIVPVSNVDGLFENLMLAGGTVYGIDYEWVFDFPVP
AKFLHYRNLLYFYRRYEGILKASQQEIFSGFGIGEELQEIFASMEERFQSYVHGQGGFAY
MKQYEQETKTLEFLLDRESELYKVKEWCEALKQEIAEKDVTIVKQQEVQRLTNNHVANLD
VIIGDLRRENAEIAKTLQYLARHEAIMWKVLRKIHHGVDRILPKGTRKRKVLQYFKNTVF
HPGKYGKLYFSADGRNRIRGDFKIGEGYLEHGKLRFEKTENPEVSIIIPVYNQIHYTYAC
LLSILEHTKDVSYEVIIADDVSTDATKELTRYVENVVICRNSTNQGFLRNCNQAARAARG
TYVMFLNNDTQVTPGWLSSLVSLIRSDDTIGMVGSKLVYPDGRLQEAGGIIWSDGSGWNY
GRLDNPDKAEYNYVKDVDYISGAAILLSRKLWEQIGGFDERFAPAYCEDSDLAFEVRKAG
YRVVYQPLSKVIHFEGISNGTDVNGTGLKRYQVENSRKLREKWADEFRKQCVNTGNPNPF
RARERSMGKPVILVVDHYVPTFDKDAGSKTTFQYLKMFLKKGYVVKFLGDNFLHEEPYST
TLQQMGIEILYGPEYQAGIWNWITRNKDEIDFAYLNRPHIATKYVDFLRQNTDIKIIYYG
HDLHFLREYREYELTGDIQKKRDSDYWKSIEFSLMEKAAVSYYPSYVEEEAIHAVKPELP
VKAITAYVYETFLDHPDMDFEKREGLLFVGGFAHPPNADAVLWFAREVYPLIRKNLNVPF
YIVGSKVTDEIRALEEPGNGIVVKGFVTEEELARLYAESRLVVVPLRYGAGVKGKVVEAI
YNGAAIVTTSVGAEGIPDAEQVMKVADEPEAFAAAVTELYGDADALRAMSQATQSYIRDH
FSVDAAWKIIEEDFRKEPEENM

Enzyme Prediction     

No EC number prediction in MGYG000002628_01728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	405	654	4.2e-27	0.8813559322033898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	5.78e-51	406	615	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.56e-46	401	643	2	251	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	3.30e-24	405	525	1	124	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13692	Glyco_trans_1_4	7.98e-24	866	1002	4	138	Glycosyl transferases group 1.
COG1215	BcsA	9.23e-24	393	619	45	269	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN93838.1	0.0	6	1035	268	1314
QRP41495.1	0.0	6	1035	268	1314
QJU21849.1	0.0	6	1035	268	1314
QIX92521.1	0.0	6	1035	268	1315
ANU46567.1	0.0	6	1035	268	1315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S22_A	4.29e-10	402	648	183	446	Crystalstructure of the TgGalNAc-T3 in complex with UDP, manganese and FGF23c [Taeniopygia guttata],6S24_A Crystal structure of the TgGalNAc-T3 in complex with UDP, manganese and the peptide 3 [Taeniopygia guttata]
1XHB_A	2.76e-08	389	648	16	291	TheCrystal Structure of UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase-T1 [Mus musculus]
6E4R_A	6.13e-07	399	647	66	329	CrystalStructure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9B [Drosophila melanogaster],6E4R_B Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9B [Drosophila melanogaster]
6E4Q_A	6.15e-07	399	647	66	329	CrystalStructure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster],6E4Q_B Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster],6E4Q_C Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster],6E4Q_D Crystal Structure of the Drosophila Melanogaster Polypeptide N-Acetylgalactosaminyl Transferase PGANT9A in Complex with UDP and Mn2+ [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.28e-21	402	653	625	885	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	4.54e-18	393	622	565	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q8MYY6	1.35e-10	404	648	112	381	Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2
P9WMY3	2.31e-10	435	622	35	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P9WMY2	2.31e-10	435	622	35	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002628_01728.