CAZyme Information: MGYG000002622_00678

Basic Information

• Species: Phocaeicola sp900546095
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546095
• CAZyme ID: MGYG000002622_00678
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	MGYG000002622_4|CGC1	95187.3	6.5596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002622	3429958	MAG	China	Asia

• Gene Location: Start: 46931; End: 49531 Strand: +

Full Sequence      

MKKTYPILRLALAAFISTAPILSYAQPTPIYKDPSQPIEARVQDLLGRMTIEEKTAQLRH
IHEGSILNDDRTLNLDKMKNIIGTLGWGAVEGLTLTGTEMARYTRQIQQYCIENTRLGIP
IFTVSESLHGAVQDGATIFPQAVALGCTFNPGLAYQMTKAISGELKAMGVNQVLSPVIDV
IHELRWGRVEESFGEDPFLVSQMGVHEINGYIDGGISPMLKVLGPHGIPTSGLNLASTEA
GERDLREFYLKPYEVAVKRTGVNAVMTAYNSTNRIPNTASKWLLTDLLRTEWGFKGYTYS
DWGAVSMLYSFHKVAADAEEAAKMALEAGTDLEASSDCYARIPEMVRSGKLDIKYVDQAC
SRVLYAKFKAGLFENPYGLPLEEYDAKVHTEEHIALSRRISEESVVLAKNDNNLLPLDIN
SLRSIAVIGPNANQVQFGDYTWSRDNKDGITPLQGIRNLAGNRLDVHYAAGCDLVSDNRS
GFAEAVAAAKKSDVVLLFMGSASASLARDYSNCTCGEGYDLTDLNLTGVQGDLIKEIYAT
GKPVILIMATGRPFSIAWEKEHIPAILFQWYGGEREGEVIADILFGKVNPSGSFCYSIPQ
SVGHLPVHYNRLPSDKGFYRSPGRINRPGRDYVFSDPEPLWAFGHGLSYSHFEYGDVRFN
KNTYSLTDTVHIRVNVKNTSAIEGKSTVQVYVRDLVSSVVMPAKQLKGFAKVTVPASGNA
TAEIAVPVDELGLYDKNMQYAVEPGDFEFMIGTASDNIFFKKTLHVGEKQDKMEKKALPQ
AEVTPTAKGKSMTVRGIVRDVQAKALDNVQVSVKGEKGSVSTNEKGEYTIRATSAGTLVF
NKKGYETKELEVKAQNTLNVTLSNKF

Enzyme Prediction     

No EC number prediction in MGYG000002622_00678.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	333	2.1e-64	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.41e-165	1	755	1	754	beta-glucosidase BglX.
COG1472	BglX	9.49e-88	49	464	1	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.22e-82	116	753	78	763	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.23e-69	50	364	1	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.99e-63	405	649	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT79418.1	0.0	25	866	19	861
CAH08599.1	0.0	25	866	19	861
BAD49815.1	0.0	25	866	19	861
CBW23400.1	0.0	25	866	19	861
AKA52536.1	0.0	25	866	19	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.29e-177	29	766	5	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.60e-176	29	766	5	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.00e-132	9	758	5	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	5.49e-127	36	758	8	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.98e-126	36	758	8	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	6.23e-139	114	755	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.95e-119	31	763	29	750	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	1.26e-114	39	758	35	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.07e-113	39	758	35	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	4.03e-79	116	766	34	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000255	0.999097	0.000172	0.000164	0.000157	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002622_00678.