CAZyme Information: MGYG000002621_02599

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_02599
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		96246.76	5.6819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 16580; End: 19132 Strand: -

Full Sequence      

MKYISTLFLLLWMSVLSVQAADQFVTFAPSEGGLTLYAAGSPAPTIWCSDDDHKGVLMAV
ENLQADFEKVVGVKPGKVTAAAAGVKIIVGSADRSPLIKQLIKAKKLDKKQLEGAREKYI
ITTLHAPLEGIEGDVLLIAGSDKRGTIYGIYELSRQMGVSPWYWWADVPVPTREAVCVRP
GVYTDGEPAVTYRGIFLNDEAPCLTGWVKHAFGTNYGGHEFYGKVFELILRLRGNFLWPA
MWSWAFYADDPENGKLADEMGVIIGTSHHEPMARNHQEWARKRKEYGAWNYSTNKEVIDQ
FFREGIERMKGTEDVVTIGMRGDGDEAMSEDTNVKLLEDIVDNQRRIIKEVTGRPAKETP
QVWALYKEVLDYYDKGMRVPDDVIMLLCDDNWGNVRRLPNAEERKHPGGFGMYYHVDYVG
APRNTKWLNVTPIQGMWEQLHLTYEYGVDKLWVLNVGDLKPMEYPITLFLDMAWNPLAYT
AENFMQHPRRFCAQAFGEEQADEAARILNLYSKYNGRVTAEMLDARTYNLATGEWKQVAD
DYAHLEAEALRQYLTLAPAYRDAYKQLILFPVQAMSNLYEMYYAQAMNHKLYAEGNPEAN
TWADKVEKAFARDKALSDDYNNVMSGGKWKNMMIQKHIGYTSWNDNFPADRLPKVFRIVE
PEKAVGGYVFTGADGYVAMEAPHFFECQAAEGTSWKVIPDMGRTLGGVTLMPYTVPVAGS
SLSYKMKLPEEARNLKQVKVIVVVKSTLAFQDVEGHKYTVGFRGGNEETVNFNHNLNELP
ENVYSVFYPTVARRVIEKEVTLTLPASSDGTYTLDFKPLHPAVVLEKIVVDLGGYRKSYL
YMDESECTRK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	39	828	7e-282	0.9885222381635581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	186	522	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.62e-33	669	840	1	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.57e-07	63	153	40	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54071.1	0.0	7	849	4	842
QUT26893.1	0.0	7	849	4	842
QUR44901.1	0.0	7	849	4	842
CBK67960.1	0.0	7	849	15	853
QUT32427.1	0.0	7	849	4	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	7	850	15	854	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	35	845	18	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	35	845	17	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.27e-185	30	659	10	634	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.35e-120	55	646	31	648	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999174	0.000147	0.000155	0.000137	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_02599.