CAZyme Information: MGYG000002621_00909

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_00909
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760	MGYG000002621_6|CGC3	84551.71	6.3744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 99440; End: 101722 Strand: -

Full Sequence      

MIKMKKIFALCLLGSMSLASYAKDWEKQLPYQNPKLSVEERVEDLIGRMTLEEKLYQMSA
IYFGKNAEIFDATGEYSMDEVRKQFGTHGVGHLSCPTTDMSARQAVRTGNKIQRIAVEET
RLGIPVIIDAEAIHGLRATGATSYPQSIALSCTWNTELMGRIADAIGQETYSRGIHQVLS
PTLDLARDPRHGRLDECYGEDPYLASRMGVEFIKGVQKNRVICSPKHFLANFVGDGGRDS
GNAGMSERELREIHMPPFEAAVREAHVKSLMAAYNSLDGIPCSANRWLLTDVLRKEWGFD
GYVVSDWSAVNHVHGALHIAPTKAEAAALCAKAGMDVELPRLNTYVKLDEMIRQGKISEE
DINENVRHILRVKFEMGLFEHPYVDEALAEKLCDAPHFRSLAREAARQSIVLLKNEKNLL
PLKGARKIAVMGPNADVVQLGGYSAKGVSGVSPLQGIRNIWGNRAEITFTKGCGMTDNSK
DGFEQAIKNAREADACILVMGGANWHTGGETRDRNNLDLMGVQEEFIEEIAKTGKPIVVV
LVEGRPVTMTRWMDKADAIVMMFYAGEEGGNALAEVLAGEVNPSGKLSLTWPRNTGDLPM
CLLHRPYGREGRIVEYDNNGKDFLPKDRYVPLYPFGYGLSYTTYTYTNLKLEKTAIKEGE
DIRFTVDVTNTGQMDGDEIVQVYLTDLYCRITQSKKRLKAFRRVHIPAGETCTVSFTLPY
SSLSFLNEYLKPEVEAGEFELRVAPNCMEGLTVRLTAEGK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	118	340	1.4e-76	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.59e-164	4	743	1	750	beta-glucosidase BglX.
COG1472	BglX	1.18e-100	49	460	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.36e-96	111	728	65	753	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	7.58e-76	50	372	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.25e-74	410	641	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW11231.1	0.0	27	756	9	742
AOW11394.1	2.74e-311	49	760	1	716
AOW11229.1	3.71e-263	37	752	8	725
ACK42995.1	1.52e-229	35	741	3	738
ACI20082.1	1.45e-224	75	743	85	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	9.30e-145	31	743	7	741	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.31e-144	31	743	7	741	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	6.40e-144	31	756	36	783	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.03e-125	42	756	14	750	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.63e-125	42	756	14	750	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.86e-149	121	743	62	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.65e-125	42	741	38	748	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.92e-123	42	741	38	748	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.21e-122	20	749	18	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	1.56e-106	121	739	34	649	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000600	0.998467	0.000309	0.000200	0.000204	0.000178

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_00909.