CAZyme Information: MGYG000002620_01493

Basic Information

• Species: Desulfovibrio desulfuricans
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio desulfuricans
• CAZyme ID: MGYG000002620_01493
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	MGYG000002620_6|CGC2	33611.49	7.8253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002620	3478150	MAG	China	Asia

• Gene Location: Start: 201299; End: 202186 Strand: +

Full Sequence      

MSFSIDVAAIQRTALVKVDGGLGSQMWQYALSLAVGKHSSFTVKHDLSWFRHYGKDIRGV
ENRFFILNRVFTNINLRFPSENERLFFHIALNHYPDSICNFDPDILALKQPTYLGGYYVN
AQYVTSAEKEIREAYVFAPAVEESNQAMLQTIHAAPMPVAVHVRRGDYIGSMHEVLTTRY
FERAFKILAAAVQPKPTFFVFSNGMEWTKKAFAGLPYDFVYVDANDNDNVAGDLFLMTQC
KHFIISNSSLSWWGAWLSQRAENKTVIMPSKWRGGKSPIPGECMRVEGWHMCPVE

Enzyme Prediction     

No EC number prediction in MGYG000002620_01493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	15	274	8.4e-56	0.9202898550724637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.48e-53	20	280	9	263	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	7.05e-19	16	260	4	268	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO40637.1	1.26e-214	1	295	1	295
ASU36804.1	3.22e-40	15	277	3	277
SDS01831.1	1.94e-39	11	272	4	279
VCU62087.1	2.72e-39	15	272	8	269
QDC97835.1	7.53e-39	15	272	3	265

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	2.31e-19	160	277	171	290	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q10983	2.68e-09	114	258	156	308	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Oryctolagus cuniculus OX=9986 GN=FUT2 PE=1 SV=1
Q28113	1.52e-08	114	258	148	300	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=FUT2 PE=1 SV=2
Q10984	1.57e-08	116	258	160	310	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Fut2 PE=1 SV=2
Q10982	3.62e-08	159	258	193	296	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Sus scrofa OX=9823 GN=FUT2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002620_01493.