CAZyme Information: MGYG000002620_00513

Basic Information

• Species: Desulfovibrio desulfuricans
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio desulfuricans
• CAZyme ID: MGYG000002620_00513
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		69708.72	8.6386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002620	3478150	MAG	China	Asia

• Gene Location: Start: 244221; End: 246059 Strand: +

Full Sequence      

MLLSTKPSSKLTPQLPLDVEIYPKAKSDRRLAPDIPGRGGSRRGAHQRYEAQLQVSVYDA
SEESAPVRCLSEDLSSSGMLLHWTEDAPLPAEGQKFVLRFTMPPGTLPEGYESRVRIPAD
VVRIVEGEDGEKKVAVNFVRNLDNYLRLKKWLRLIATSVVLLAISVYAVAYMRQESLFYF
MFDVPVFTYGIVASVFLVSRFVFSFFYRNVPVDPDFTPGVTIVIPCFNEEEWIEKTIQCA
INQDYPQEKLEVILVDDGSTDKSMERVRRIEKQIRKEITGDRFVVIEQPYNMGKRHALAA
GAQHAKFELLVFVDSDSFLEPDAVREVVQPFRDPKMGAVSGRTEVQNKWTNALTKMQAVR
YYVAFRFIKAAESVFDGVTCLSGPLACYRKDLVLHYLDEWLNQKFFGYPATFGDDRSLTN
YILAHHRTGYQDAAVCSTIVPSSMRTFIRQQMRWKRSWLRETLRASSFMWRKEPFMALSF
YIGFLLPVLAPLVVVRTMVVIPIELGLFPYKYLAGILVTSMLMSASYLLFKRSNLWPYGI
VFCVFYLAVLLWQLPVAVLTFWKSEWGTRNTSADVAAQEKLRYEQKMFVMPSESAVAAGA
GQPADHGKHGEG

Enzyme Prediction     

No EC number prediction in MGYG000002620_00513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	221	393	4.7e-32	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	4.65e-55	222	394	1	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06434	GT2_HAS	4.57e-53	220	457	2	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	1.84e-46	171	563	5	385	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06439	CESA_like_1	2.96e-46	208	455	19	241	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
PRK11204	PRK11204	1.10e-39	176	561	5	395	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO41705.1	0.0	1	612	1	612
QAZ68702.1	1.21e-206	20	574	3	550
AZK46434.1	2.10e-203	48	580	65	605
ACX64318.1	4.76e-200	48	580	68	608
ARC85988.1	7.22e-200	19	580	13	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	3.27e-29	189	590	47	479	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.41e-28	189	590	47	479	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6YV7_B	2.34e-19	209	441	33	249	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.37e-19	209	441	34	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6P61_A	4.29e-12	218	324	13	110	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DB61	1.80e-47	189	463	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=hasA PE=3 SV=1
P0DB60	1.80e-47	189	463	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=hasA PE=3 SV=1
Q5X9A9	1.80e-47	189	463	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=hasA PE=3 SV=1
Q8NKX1	3.44e-47	189	463	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=hasA PE=3 SV=1
P0C0H0	3.44e-47	189	463	36	307	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
151	170
177	199
473	495
508	530
540	562