CAZyme Information: MGYG000002616_00217

Basic Information

• Species: CAG-495 sp001917125
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp001917125
• CAZyme ID: MGYG000002616_00217
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000002616_2|CGC1	40889.49	9.9242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002616	1919079	MAG	China	Asia

• Gene Location: Start: 33470; End: 34591 Strand: +

Full Sequence      

MKPTKKTASEKPLIILTAGGTGGHVFPAESLAEELLRRGYRLALVTDSRGKDNYQGKLSE
IPNYSVCSGALVGKSKLFKIKSLIKTCWGVVQAAYILFTRKPACVIGFGGYASFPCSMAA
ILLGIDLIIHEQNSVMSRTNRFLSKYAALIAQSFRNAKYTPPHIKTILTGMPIRTAIADL
NKQTYPEIKDGHYNLLVIGGSQGAKIFGEVIPEAIRKLPQELQKKLTVTQQCRKADIEDV
EPRYQDCACRVNISSFFKNMPELYTTSHLIISRAGASSVFEIAAAGLPSVLIPLPTAADD
HQTANARYITGAKGGIAIPQKEFTPEKLASVLTDLFQNPQKLRQMSDNIRWAAITDASQR
FADAVEKEIIAKR

Enzyme Prediction     

No EC number prediction in MGYG000002616_00217.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	195	356	2.9e-49	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.25e-141	11	369	1	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.82e-128	14	363	2	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	9.71e-112	14	370	3	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.98e-103	14	365	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	2.08e-48	194	361	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10292.1	1.36e-154	6	369	2	366
ARJ66991.1	6.50e-95	13	365	7	361
CDK99712.1	1.78e-94	11	365	3	359
BAE52652.1	5.21e-94	8	365	2	361
CUW38580.1	7.37e-94	8	365	2	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.29e-64	14	364	5	350	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.70e-60	4	367	2	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	7.73e-41	14	367	9	352	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W0H3	1.04e-94	8	365	2	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=murG PE=3 SV=1
Q2RVU4	2.25e-86	14	365	19	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=murG PE=3 SV=1
B6IRG2	5.00e-86	14	365	6	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=murG PE=3 SV=1
Q0BV25	2.92e-83	5	369	2	368	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=murG PE=3 SV=1
B7KSC1	1.05e-82	12	365	6	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylorubrum extorquens (strain CM4 / NCIMB 13688) OX=440085 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
103	125