CAZyme Information: MGYG000002613_00222

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002613_00222
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000002613_6|CGC1	76776.29	6.0757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002613	2968338	MAG	China	Asia

• Gene Location: Start: 25931; End: 27976 Strand: -

Full Sequence      

MILKSHNLILCAALFFCPASLTAKDKVSVVERPSAGVNSSYTNFRAPLVQAPLIKLPVGK
VQPKGWLRKYLELQKEGLNGKLGTVSAWLDKNNNQWLSDNGDHGWEEVPYWLRGYCSLAY
ILDDEEMKKESQVWFDTVFANLKSDGFLGPRNYEGDNPELWAQMVMLWAMQTYYEHSGDE
RVLSAMTNYFKWEMTVPDAKFLKGLWQEKRGGDNMWSVLWLYNRTGDKSILPLIDKLHKN
TSDWTQKGTLPNWHGVNVAQGFREPATYYMYTGNKDMLEATYNGFNTMRECYGQVPGGMY
GADENARDGYADPRQGAETCAIVEQMASDEILMGITGDPFWADHCENVALNTFTAAMTED
MKALRYITSPNMAISDEKLHGPSIDNNLRGMLSMSPFSSRCCQHNHGMGWPYYTEHLVMA
TADDGLATMLYAASVTTAKVADGRTVTLTETTNYPFDETVTLKLNTNGKVTFPLYLRIPV
WAKGTMVRINGKKQPVSDAAGKYVCLQRQWENGDVVTLTLPMSVHSHVWQKNKNSVSVNY
GPFTLSLKIDESFEQYDSRDKAFVQDDSHWQNGVDALLWPCYVLKPKSAWNYALKLDGNN
LPLKFTVKRKPWPVDDFPFNLKNVPLEFTAVGVQIPSWGYDATGMTDVLPSVDAPRSTVE
TPLTLVPMGAARLRISAFPQE

Enzyme Prediction     

No EC number prediction in MGYG000002613_00222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	174	545	2.7e-36	0.7137176938369781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.95e-97	93	546	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.64e-22	317	547	291	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07470	Glyco_hydro_88	5.58e-05	88	239	1	156	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL79118.1	1.58e-162	35	679	33	662
QMU76753.1	6.68e-157	46	679	53	668
QKW18167.1	6.10e-156	46	679	56	668
ADJ45365.1	4.06e-155	41	679	44	660
AFO77076.1	4.06e-155	41	679	44	660

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	8.59e-19	107	548	78	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.23e-16	107	548	78	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	4.37e-15	315	605	334	618	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	9.08e-14	315	605	334	618	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000839	0.989647	0.008902	0.000246	0.000185	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002613_00222.