CAZyme Information: MGYG000002603_00387

Basic Information

• Species: Prevotella sp900767615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900767615
• CAZyme ID: MGYG000002603_00387
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000002603_2|CGC4	61661.65	8.533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002603	2739364	MAG	China	Asia

• Gene Location: Start: 180868; End: 182520 Strand: -

Full Sequence      

MKKMKIKSFLIASLAAFSLTAGAQSLSPNTKWHWDKGTIVVETPERPAGQQNVLGLKAPK
LQTVRVGFVGLGMRGPWAVMRFCHIPGVEIVALCDYEEERAEKSQEFLRKQGLKPAAIYS
GEKGYEELCKRPDIDLVYIAADWNHHFPVAQCAMENGKHTAIEVPSAMNLDQCWSLINMS
EKTRKHCFILENCCYDYYEMNALAMAQAGVFGNIIRAEGAYIHCLEDFWDAYWKDPNDND
KDNLHWRMKYNMENRGDVYPTHGLGPVAQCLNIHRGDRFTTLVAMDTESFVGKDWVSKKS
GKECKEYRNGDHTTTLMRTAKGKVVEIQHNVMTPQPYNRLFKLTGTKGYATKYPTEEFAL
SGDALKGTGAPQMDNLNAHGFMNKEQKAALVKKYYHPILKKYGELGRQMGHGGMDFIMDS
RLVYCLQNGLPLDMDVYDLAEWCSLAELGAISMDNNCAPVTFPDFTRGFWNKEQGYKHQY
ASPADEAATEAAAAAYTKAQKEATAKYNLWKLYDAVAAAKKTNNAKAVKSATAKYNKAVA
AAKKAMVAKK

Enzyme Prediction     

No EC number prediction in MGYG000002603_00387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	60	472	1.3e-152	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.45e-20	62	374	2	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.08e-12	64	189	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	6.77e-06	63	214	4	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38645.1	4.54e-304	4	519	1	516
QQY38775.1	4.54e-304	4	519	1	516
QFQ13386.1	4.91e-271	1	518	1	520
QCQ31109.1	2.00e-267	3	506	7	509
ALK83890.1	7.30e-261	20	506	24	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.77e-93	46	470	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.41e-66	64	470	21	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	4.33e-07	63	221	7	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
1ZH8_A	3.84e-06	61	348	16	267	Crystalstructure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8],1ZH8_B Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KYY1	9.08e-305	4	519	1	516	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6L1Z2	8.41e-261	20	506	24	509	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	8.75e-255	5	506	3	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
Q89ZX8	8.14e-195	6	481	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	2.59e-190	10	481	8	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000401	0.998695	0.000319	0.000229	0.000184	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002603_00387.