CAZyme Information: MGYG000002601_01039

Basic Information

• Species: CAG-110 sp900549705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900549705
• CAZyme ID: MGYG000002601_01039
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000002601_30|CGC1	88384.37	4.1803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002601	2683696	MAG	China	Asia

• Gene Location: Start: 4734; End: 7178 Strand: +

Full Sequence      

MKRTNRVLSAMLAAAMVLSAGVQGVKADSAKWTETETADGWMLVTNEGGKTLGYSKTSGV
KLLEVDGFAFKDLDKDGELDVYEDWRESYETRAHDLVNQMSGEEIAPYLTHGGWGTFTDD
RDTFRNTETNAKGMEYIMGGGRGGVTRNLGSNQEGNVKHAKWVNLIQELCEELPYGLPAM
VSIDPNGQSGIVQTLSLASTFDPELAVAVGKEYSKQYRAAGVTMMLGPQVDVASSPLMQR
GGGTYGEDPALSRDIAEGFVSGMQSTWAEDGTDLGWGEDSVLAIMKHWVGAGAQEGGRDD
HSSEFAVYPGHNFEAQLIPFVDGAFKLTHSVTGVAGGIMTNYSVNADLVNKLYYEGEDYY
AGAFSSYKYDLLKEIGWDGYIISDWGPLSGGNGSWGWKDYTNAERIERTIELGMNQMGGF
SGLDDMAEAWELLAEDHGEEEALELMRTCAYKNVIASMRLGLFDNPYCSTEKVMETNCTA
ESLAYGIETQEKAMVLLKNDGTIKDNTASEEKLTVYVPAVFTAGATNAWSGKYTPASAKP
GMSLAALEKYYNVITDTIGAPTGTAPDGTAELQLSDITAPSAEELAKVDLVIVPMTGPYT
ASTVDANYDESNDEEYGMYTAPSLQYKPYTAAGARNPSIGGEVKIVTFSDGYTMQTSSRK
QNLSYWNKTAGNDANISHLEKLEAIKAMNLEAPIVVVMSANRSGAMVWSEVEPLADVIFY
RYGSVSDDAAVELIAGKVEPSALLCQQQPASMKAVEQEMEDVSRDLECYVDANGNTYDFA
YGLNWSGVINDERVATYSAAPLTHVENMQFHYAQ

Enzyme Prediction     

No EC number prediction in MGYG000002601_01039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	176	413	4.5e-33	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.61e-29	125	539	13	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.95e-14	124	415	14	280	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	5.08e-12	195	501	124	402	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ97597.1	5.17e-220	31	814	82	851
QOY60939.1	6.94e-146	30	806	58	808
QGY45729.1	3.13e-143	31	802	49	832
QIA06569.1	4.06e-142	31	802	49	827
AJQ29699.1	6.82e-140	9	802	4	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	3.01e-13	128	503	71	422	Crystalstructure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5XXL_A	9.64e-12	156	513	62	391	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.80e-11	156	513	62	391	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	3.00e-09	194	503	91	373	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
7EAP_A	3.06e-09	82	499	7	394	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46684	3.56e-44	57	503	33	490	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
Q5BCC6	5.93e-30	79	503	35	451	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
B8NGU6	6.58e-30	75	530	35	484	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
Q2UFP8	8.98e-30	81	530	45	488	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
P07337	3.03e-08	176	586	37	411	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.998894	0.000265	0.000196	0.000176	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002601_01039.