CAZyme Information: MGYG000002587_03244

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_03244
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002587_104|CGC1	43065.7	6.9347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 7098; End: 8216 Strand: -

Full Sequence      

MKYIVNFLVTVCLFMSMTQSANAQKDYFKDLPENCSPEKVGAILSRHFIPSKHMWYGKGK
WIHYAEVCTWYGALRYAEITGDKQLAEQLKDRFDLLVTTEKSHLPIMNHVDLNVFGCIPL
ELYKITKDKKYLEMGLSYADTQWTLPANVTSEEKAWADKGLSWQTRLWIDDMFMITILQA
QAYHTTGKREYMDRAVKEMVVYLDELQRSNGLFYHAPDVPYFWARGNGWMAVGMAELLLS
TPEDNPNHARILERYRLMMKSLKDYQNKSGIWNQLIDKADCWPETSGSAMFTYAMIMGVK
KGWLDAEEYGPVARKAWIALVPCINKDGDVEEVCIGTGKKNDLQYYYDRPRIAGDYHGQA
PMLWCTYALLCK

Enzyme Prediction     

No EC number prediction in MGYG000002587_03244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	368	8.8e-76	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.87e-54	69	365	34	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.97e-51	46	363	25	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDW23918.1	1.66e-176	8	372	5	368
QDO68163.1	5.27e-176	7	370	9	369
QUT50302.1	1.19e-175	134	372	1	239
BCA52191.1	2.15e-174	19	372	15	367
QUT73021.1	2.15e-174	19	372	15	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.54e-42	29	364	45	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	7.05e-36	63	358	40	353	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.02e-35	63	358	30	343	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.04e-22	168	322	158	331	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.49e-20	168	330	141	318	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.86e-35	63	358	40	353	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	3.60e-19	129	330	129	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	7.62e-18	129	330	131	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P0A3U6	3.85e-15	179	363	6	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.85e-15	179	363	6	222	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999183	0.000147	0.000151	0.000136	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_03244.