CAZyme Information: MGYG000002587_02740

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_02740
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		70439.48	7.1772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 4996; End: 6873 Strand: -

Full Sequence      

MMIPFKVKTFSFLLACACSTAGMAQVVDNSPVKQVKISGYVGTRIADCIEHRVKAQDVDH
LVEPFRHQNEKSRWQSEFWGKWIQGAIASYRYNRDPELYRIIKDAAESLMATQQPDGYIG
NYAPEYQLQQWDVWGRKYTSLGLIAWYDLSGDKKALEAACKVVDHLMTQVGPGKADIVST
GNYIGMPSSSVLEPVMYLYNRTKEARYLDFANYIVGQWETPGGPQLISKAIAEVPVANRF
PHPKTWFSRENGQKAYEMMSCYEGLLELYKVTGNPLYLSVVEKTVGHIVREEINVAGSGS
AFECWYGGKERQTQPTYHTMETCVTFTWMQLCNRLLQMTGNSLYADYMETAIYNALMASL
KADASQIAKYSPLEGWRHEGEEQCGMHINCCNANGPRAFAMIPQFAYQVQDDCVRVNFYA
PSEAELLLPGKKPVRLIQTTDYPGTDLIEIEVDPAKETVFTIALRIPAWSKIATVSVNGR
PEDGVLQGAYLPVSRKWKKGDRITVKLDLRARLVERNQAQAIVRGPLVLARDSRFGDGFV
DEASVVVSKDGYVELTPVEAPAFAWLAFTAPIVLGTDLESNRAPKQIHFCDFASAGNTWD
KTQRYRVWLPKTLNVMHSPYKPYNQ

Enzyme Prediction     

No EC number prediction in MGYG000002587_02740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	67	529	7.4e-64	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.42e-70	80	530	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.76e-68	31	530	13	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	2.99e-238	29	625	21	622
QOY86860.1	3.97e-48	81	543	97	564
ADH61394.1	1.08e-45	31	528	13	557
AXC10260.1	1.78e-45	81	531	133	592
AGB41651.1	3.28e-44	81	554	76	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.06e-34	47	528	40	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	3.45e-34	81	535	74	553	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	3.81e-32	47	528	40	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.73e-28	75	533	90	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	2.11e-23	321	530	337	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.51e-20	81	583	80	630	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001222	0.591547	0.406310	0.000361	0.000286	0.000236

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_02740.