CAZyme Information: MGYG000002587_00292

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_00292
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MGYG000002587_3|CGC1	89131.96	6.785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 78244; End: 80595 Strand: +

Full Sequence      

MKAYFPPLLLACIFFVTTLSIQAQQSIYVSPTGNDRNAGTKEAPLASLPAAIKVIRTSTE
QDITLFLQNGIYHLEQPLTFSPDILAGKKLRITASAQSDSVIISGNKKLSLQWKQGKQGL
WEAQTEESFDQLWIDGNPRILARYPNYQKDTLFNGTAEDALSPKRIKRWKNPEGGYIHSM
HAGMWGSQHYRIMGKVKDSLIYEGGYQVSRPSKIHSTLRFVENIREELDSPGEWFLDKNR
QILYYYPLPGENMDTIEAEATVTPHLFVIRGTKNEPVRNVCIDGITFTHTRRTFMEPYEM
LMRSDWGIYRGAAVLFENTEDCKINNCEFKELGGNAVFLSSYAYQDTVISNHIHHTGGSA
ICMVGDTSAIRSGAYGYSKYIPFEQMDRTPGPKNKQYPRQCLIEDNLIHDLGTVEKQVAG
VEIQIAAILTVRHNTIYDIPRAGINIGDGAFGGHLIEYNDVFNTVLETSDHGAFNSWGRD
RFWHPKYNEMARLTDEHPELILADALYTNILRYNRFRCDHGWDIDLDDGSSNYHIYNNVC
LRGGIKLREGFFRKVENNILVNSSLHPHVWFKDSKDVVRRNLFMQPYYPISLNGWGEQLD
YNFFTSRMALDNVRKNQTDTHSITGTFDFTDAVGGNYTLKPDSKVFEIGFENIPMDRFGV
YSQRLKALAKTPEFPLIQIIDVNNENKSYAWLGATIRIVNGLGDRSAFGLPDERGIVITN
VEKGSLADKAGLSRNDVIRIMADKDISTIEEVFALTEENRWKGKVFVTIIRNQTEEKIQI
KFK

Enzyme Prediction     

No EC number prediction in MGYG000002587_00292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	26	540	4.7e-70	0.9886148007590133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00987	PDZ_serine_protease	2.68e-14	690	780	1	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
COG0265	DegQ	7.98e-07	631	782	206	338	Periplasmic serine protease, S1-C subfamily, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones].
pfam13229	Beta_helix	1.02e-06	311	457	23	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00136	PDZ	1.70e-06	691	783	2	70	PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1, a mammalian tight junction protein.
cd00989	PDZ_metalloprotease	2.04e-05	717	782	15	79	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	7.39e-210	12	767	15	784
BAU63437.1	1.99e-52	28	660	58	728
AFZ35556.1	6.81e-43	28	660	49	710
QGA25764.1	3.12e-37	15	661	11	663
ALJ04165.1	1.45e-36	15	560	12	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	4.02e-21	27	449	27	501	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.998962	0.000211	0.000169	0.000152	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_00292.