CAZyme Information: MGYG000002580_00621

Basic Information

• Species: Lachnospira sp000436475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp000436475
• CAZyme ID: MGYG000002580_00621
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000002580_2|CGC8	59242.75	4.2756

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002580	3016685	MAG	China	Asia

• Gene Location: Start: 291750; End: 293399 Strand: +

Full Sequence      

MKKKSIVAAISALSLIVSMNTGIGSVFAGEQSTVPGTAEQPFVVTDGLFDQTKTESDLGL
SKIEGAETVTVFTATDDTDHYCNGVVMTEFKGKLYTQWQSSAKDEDAEDTWVAYSVSDDN
GATWSEPKVLVPTIDNGYCSSGGWFVSGDTLVSYINVWYSDTTPRGGFAYYVESTDGEHW
SEMKPVLMKDGTPMEGIIEQDPHVLASGRIVNAAHFQPGLFAYPIYTDDPSGTKGWVKAQ
YTCMEQGEGATTSREMEPSLFVNEDGTIVMTFRDQKSSFVRLAAISTDQGETWSETVSTN
MPDCRAKQSAGNLPDGTAYLVGCSVNNKGRWPLTITLSSDGKTFDTAYVLRTHDEFPELK
YTGKAKRLGFHYPKSVVIGDYLYISYATSKEYVEYTRIPLDAISLNADKEAPVISGIEDG
AEYTDSVTFTVEDANLKSVTVNGEALTAEDGKYTLTVSDGQQVVVAEDEAGNKTVVKVMV
KASANNSTEDTTTATDAAENTNTNSDSNSNSNVSTPQTGDIMMRVAAIMAGLLLASGLVI
FAAGKKRRA

Enzyme Prediction     

No EC number prediction in MGYG000002580_00621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	91	350	7.5e-19	0.6198830409356725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	1.39e-50	92	384	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.93e-28	69	372	1	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	0.001	245	399	230	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
TIGR01167	LPXTG_anchor	0.008	516	548	3	34	LPXTG-motif cell wall anchor domain. This model describes the LPXTG motif-containing region found at the C-terminus of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall. Hits that do not lie at the C-terminus or are not found in Gram-positive bacteria are probably false-positive. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region. [Cell envelope, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79596.1	2.76e-120	39	400	343	701
ADY61523.1	4.92e-16	81	389	277	580
QDT98687.1	6.77e-16	66	345	33	319
QDU09961.1	2.18e-15	66	345	33	319
QEG41848.1	2.65e-15	77	389	267	576

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000284	0.998933	0.000244	0.000181	0.000178	0.000149

TMHMM  Annotations     

start	end
7	29
521	543