CAZyme Information: MGYG000002574_03269

Basic Information

• Species: Fusobacterium_A ulcerans_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A ulcerans_A
• CAZyme ID: MGYG000002574_03269
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		40069.89	6.968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002574	3729499	MAG	China	Asia

• Gene Location: Start: 199; End: 1212 Strand: -

Full Sequence      

MDFKHLTQFKDIIELDKRPVKLDERETFNVSWGIDENYQVGAAISIASILENNKQNKFTF
HIIADYLDKEYIELLSQLATKYQTVIKLYHIDSEPLKALPQSNIWPVSIYYRLLSFDYFS
ARLDSLLYLDADIVCKGSLNELIALEFKDEYGAVVIDVDAMQSKSAERLCNEDFNGSYFN
SGVMYINLREWLKQRLTEKFFDLLSDESIIKKLKYPDQDILNLMFLHHAKILPRKYNCIY
TIKSEFEEKNSEYYTRFINDDTVFIHYTGITKPWHDWANYASADYFRNIYNISPWRNIPY
KKAVKKHEYKEKYKHLLYQKKFLDGVFTAIKYNVMKG

Enzyme Prediction     

EC	2.4.1.58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	26	277	8.3e-54	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15171	PRK15171	5.06e-84	24	332	22	328	lipopolysaccharide 3-alpha-galactosyltransferase.
COG1442	RfaJ	7.15e-83	26	303	1	274	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd04194	GT8_A4GalT_like	3.66e-79	28	276	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.28e-60	29	278	1	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	6.47e-16	35	275	9	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCL62669.1	3.13e-252	1	337	1	337
ATB81028.1	3.13e-252	1	337	1	337
ASE48092.1	3.13e-252	1	337	1	337
AMW43412.1	3.13e-252	1	337	1	337
QHP64873.1	3.13e-252	1	337	1	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	2.86e-14	34	274	12	252	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
1SS9_A	6.81e-12	29	289	2	267	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
6U4B_A	1.46e-11	35	304	309	597	ChainA, WbbM protein [Klebsiella pneumoniae]
1G9R_A	5.47e-11	29	289	2	267	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19817	7.38e-93	23	336	21	332	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	9.65e-86	13	336	7	334	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19816	1.58e-66	15	332	15	330	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27128	7.18e-62	24	336	25	336	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P43974	1.66e-18	26	275	37	279	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002574_03269.