CAZyme Information: MGYG000002574_02962

Basic Information

• Species: Fusobacterium_A ulcerans_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A ulcerans_A
• CAZyme ID: MGYG000002574_02962
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002574_333|CGC1	41100.97	8.3283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002574	3729499	MAG	China	Asia

• Gene Location: Start: 247; End: 1320 Strand: +

Full Sequence      

MKFFVSTGEVSGDLHLSYLVKAMLEQNKDLKFYGAAGNHSRAQGVEVIQDIEELAVMGFT
EVFKKYSFLKKKANEYIDFIKKEKINKVILVDYGGFNLKFLELLKKEVPEVEVYYYIPPK
LWIWGENRITKLVKADHIMVIFPWEVDFYKKHGVDAVYFGNPFVDKYSVIERTGNNILLL
PGSRKQEIRTLIPVMLKVVEKKKEETFLLKLSSSEHLKWIDEDLNKFENLKIVSDKSLAE
CVKESKTAVAASGTVTLELALMGIPVIVVYRTSFINAFIARHILKVGFVSLPNLTLNREV
YPELLQEKCNPEEIEKYLDYFENSKEKIAEDIAEVRKKLSGKDVVKSYGNFLIKGEQ

Enzyme Prediction     

No EC number prediction in MGYG000002574_02962.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	338	2.8e-102	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	6.54e-116	1	354	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.59e-96	1	341	2	361	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	4.14e-75	4	352	2	371	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.43e-69	5	339	10	369	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.91e-56	1	346	2	342	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQJ09670.1	4.57e-246	1	357	1	357
AVQ26961.1	4.57e-246	1	357	1	357
BBA50470.1	6.22e-244	1	357	1	357
VEH39859.1	4.89e-241	1	357	1	357
AVQ31390.1	4.89e-241	1	357	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.76e-32	8	314	14	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.11e-31	8	314	14	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QR27	4.40e-51	2	346	3	367	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1
Q39T49	1.11e-48	5	339	11	363	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	4.48e-48	5	314	14	342	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q1D393	5.86e-48	5	314	9	333	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.61e-47	5	314	8	333	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002574_02962.