CAZyme Information: MGYG000002573_00619

Basic Information

• Species: Ruminococcus_C sp900545285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900545285
• CAZyme ID: MGYG000002573_00619
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930	MGYG000002573_11|CGC1	104409.94	4.6316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002573	2234911	MAG	China	Asia

• Gene Location: Start: 30860; End: 33652 Strand: -

Full Sequence      

MIACYDLTGVWDFSMAQMRKDTVPSAFTDTISLPGTTSLAKKGSPNPNRETGFLTDAYAF
EGQAWFRKTIYVNPEHIGLPMQLTLERTRMTTLWINGKKVGSCDSLCTPHVYDISAFVTK
PLTEIVVLVENTGYPTKGGHLTSPDTQSNWNGITGEMMLRVFSDVYADHVQAYPDPDKKQ
VTLSMQLHGAKTAAFTLTGNVQFADEVIPVPVFQAQLEADQNGRASVTIPLETVYYEWSE
YQPALYFLLYQIDEQDNGFVSFGMRKFCADGTRFTINGKPTMLRGKHDGMIFPRTGYAPT
DVNEWIRILQTAKDYGINHYRFHTCCPPDAAFTAADLLGIYMEPELPFWGTIAAPGEEGY
QEAEQQYLIALGDQMLDAFGNHPSFVMFSLGNELWGSPERLGEILRHYKARDSRRLYTQG
CNNFQHFPLVLPEDDYFVGVRLSKERLIRGSYGMCDAPLGHVQTDRPSTMHQYDTIIFPE
QKEDADGEAAEEIEIQYGTGVKKVKVSKSAGGLIPTKPVITHEIGQYEVYPNFREIEKYT
GPLKARNFEIFRERLAAKGMLSQAEDFFQCSGALAAACYKEEIEAAMRSQYVAGFQLLDL
QDFSGQGTALVGMLDAFMESKGLITPEEWRMFCSDCVLLAQFPSYTLISGEMFTAKVSMR
TVLPQDGTVEWVLMNENGDTLGKGSFSGKQEPGLSEIGRIFCPMPEEISSPERLFLILSL
TDTDVCNAYDLMLYPAIAMPELETQETLCITEQLDEALAALQEGKRVLFLPTETAQSIPG
FYCTDFWCYPMFRDICNWMKKPVAVGTMGLCIQQDHPALAQFPSQKYSTPQWYDLVSAAD
CAILDDTPEGFTPIVQMIDNFERNHKLGILWEAQVGNGCLLVCTSRLSSAAERPEVRWFA
KSILSYAKSDAFRPEQKMTPEQLQKIFLPK

Enzyme Prediction     

No EC number prediction in MGYG000002573_00619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	446	1e-57	0.48404255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.16e-21	6	474	14	468	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	9.37e-10	274	418	8	159	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	3.37e-05	7	131	4	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16908.1	0.0	5	928	5	931
BAV13119.1	0.0	1	928	1	934
ADL53165.1	0.0	1	928	1	934
QKS45132.1	0.0	1	927	1	942
QAA34542.1	5.43e-318	6	926	6	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	3.67e-11	60	416	82	441	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
3GM8_A	4.23e-10	11	420	13	424	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6S6Z_A	1.64e-08	65	416	123	462	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.64e-08	65	416	124	463	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
7CWD_A	1.73e-07	58	420	60	436	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	5.02e-10	7	416	61	503	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
T2KPJ7	4.06e-09	29	399	80	436	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	8.97e-08	65	416	124	463	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q4FAT7	1.95e-06	59	418	95	480	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
Q6LL68	3.98e-06	7	393	49	456	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002573_00619.