CAZyme Information: MGYG000002564_01689

Basic Information

• Species: CAG-831 sp902388455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp902388455
• CAZyme ID: MGYG000002564_01689
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000002564_15|CGC1	40137.4	4.9399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002564	2497816	MAG	China	Asia

• Gene Location: Start: 8519; End: 9574 Strand: -

Full Sequence      

MRKILIIVVFLISLPMIAGANEQKTEFTVLQWNIWQEGTMVPGGYDAIVDEIERLRPDFV
TFSEVRNYHGTRFCDRIVASLRELATRYPSVKDFWFDGTWDASVKKNAWWTAHAEKMLKE
LVPGVTVNSRLRADDYGKRHFDSNGHLMGDYESGYERRLPDPVKDLQVTQWDWEACMTVP
ENQWGYHRDWSLSYVKTPAEVLERIIHAVAMGGNMAVNFGPQPDGDFRPEEKALASYIGQ
WMKRYGQCVYGCDYVGWDKQDWGWYTTDGEYVYMIVFNAPYSSLLTVKTPKDVSVESAVM
IDGGRALEVIETARNEYNVRMPSADPGEPFVIRLETGGSAGSGNKYRDALI

Enzyme Prediction     

No EC number prediction in MGYG000002564_01689.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	70	251	4.6e-36	0.4479768786127168

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	2.99e-50	66	290	170	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	8.53e-29	70	246	174	332	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANQ62400.1	2.80e-163	71	350	193	471
CAH05807.1	2.80e-163	71	350	193	471
AKA53992.1	2.80e-163	71	350	193	471
QCT76666.1	2.80e-163	71	350	193	471
QUU05154.1	2.80e-163	71	350	193	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JL2_A	2.48e-155	71	350	169	449	Crystalstructure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JL2_B Crystal structure of a bacterial fucosidase with a monovalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2WVV_B	7.08e-155	71	350	169	449	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2WVV_A	1.00e-154	71	350	169	449	Crystalstructure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2WVV_C Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2WVV_D Crystal structure of an alpha-L-fucosidase GH29 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4J27_A Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form [Bacteroides thetaiotaomicron VPI-5482],4J27_B Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in a novel crystal form [Bacteroides thetaiotaomicron VPI-5482],4J28_A Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a 5-membered iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4J28_B Crystal structure of a gh29 alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a 5-membered iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JFS_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor 4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFS_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor 4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFT_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor N-desmethyl-4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFT_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor N-desmethyl-4-epi-(+)-Codonopsinine [Bacteroides thetaiotaomicron VPI-5482],4JFU_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JFU_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JFV_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFV_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFV_C Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFV_D Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(methylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_A Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_B Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_C Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JFW_D Crystal structure of a bacterial fucosidase with iminosugar inhibitor (2S,3S,4R,5S)-2-[N-(propylferrocene)]aminoethyl-5-methylpyrrolidine-3,4-diol [Bacteroides thetaiotaomicron VPI-5482],4JL1_A Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482],4JL1_B Crystal structure of a bacterial fucosidase with a multivalent iminocyclitol inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2XIB_A	1.11e-154	71	350	172	452	CrystalStructure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_C Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XIB_D Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With Deoxyfuconojirimycin [Bacteroides thetaiotaomicron],2XII_A Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron],2XII_B Crystal Structure Of An Alpha-L-Fucosidase Gh29 From Bacteroides Thetaiotaomicron In Complex With An Extended 9- Fluorenone Iminosugar Inhibitor [Bacteroides thetaiotaomicron]
6HZY_A	2.32e-154	71	350	194	474	Crystalstructure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482],6HZY_B Crystal structure of a bacterial fucosidase with inhibitor FucPUG [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49713	3.30e-11	83	251	197	351	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q99KR8	7.56e-11	173	290	285	407	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
P10901	1.78e-07	77	331	203	452	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000258	0.999090	0.000184	0.000152	0.000139	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002564_01689.