CAZyme Information: MGYG000002561_00655

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_00655
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000002561_3|CGC5	73174.35	6.2614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 275370; End: 277310 Strand: +

Full Sequence      

MKKVVFLLGTLISTVSLIAGNTKELNLASPDGAHKVVFGQKQVAPQVNEVYYSVSYKGQP
VIEESCAGLDLDNRVWELALARHIEQTECWMDNMEADSVVCHASVDSIRHLFYGERNAVR
DAYNSATMYLSKKDGSNYRLNIEVRAYNEGIAFRYFFPEHPQAIFHKVVADLTEYSFPAG
TMAWTEQWAQAPFERLSINDIKHPVERALTVELPDGHWATLADADVDDWCLTKFQASEKK
PNTLTSVMYSPVDMVTYYATPWKIVMAADKPGELLEHNDIIGNLNLPCQITDVADWVKPG
KIMRETTITTEGAIATIDFCAAHNIPYMLFDWQWYMPCTSHDGDATKVVAKLDMPRVVAY
GKEKGVGVWLYVNQHALMKQARELFPILHQWGIVGVKSGFVQYASHRWATWLHDLVRLAA
ENHLMMNIHDEFRPSGFSRTYPNLLTQEGIRGNEEFPDATHNTILPFTRMINGAADYTIC
YYDKRLKTTHAHQLAASLIFYSPLQTIFWYDKPSLYQGEPEIEWFENLQTVFDDTKVLDG
TPGKNITMARRKGQEWFLGAMTNNDGSKEEVSLSFLDSGKTYLASVYTDGGDKVKTRTQV
ACNYLLVDASMTLKFDLKPSGGAAVRFVPVDKAETKKYQKYKGKIL

Enzyme Prediction     

No EC number prediction in MGYG000002561_00655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	16	627	2.5e-162	0.9873217115689382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.60e-60	295	521	3	269	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	6.39e-53	29	287	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.87e-34	532	628	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34121.1	0.0	16	646	16	647
QUU00177.1	0.0	16	646	16	647
AII66307.1	0.0	1	646	1	645
QJR54190.1	0.0	1	646	1	645
QJR61012.1	0.0	1	646	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	8.71e-54	18	626	12	653	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	8.99e-53	29	626	6	639	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5HQ4_A	2.28e-51	29	627	5	658	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	2.28e-51	29	627	5	658	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	5.84e-51	29	627	5	658	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	5.09e-57	1	626	1	660	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.49e-45	52	636	46	733	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	1.19e-39	120	624	113	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000695	0.991332	0.007303	0.000254	0.000201	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_00655.