CAZyme Information: MGYG000002561_00479

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_00479
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	MGYG000002561_3|CGC1	57526.53	5.9717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 45798; End: 47345 Strand: +

Full Sequence      

MTNFKSLLLGLCIVFGACSTQSQTSTQQTNEYGTKWQWDKGTIVVETPERPAGQQSVLGL
TTPKMEVVRVGFVGLGMRGPGAVERFTHIPGTQVVALCDYEQSRAEKCQELLKKASLPKA
AIYSGEKGYEDLCKRDDIDLVYIAADWLHHFPVAMCALENGKHVAIEVPSAMNLQQCWDL
INMSEKTRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHNLEPFWDHYWKNG
ESDKLGWRLDYNMRHRGDVYATHGLGPVAQALDIHRGDRMKTLVAMDTKSVIGKALVEER
ADSVCNSFRNGDHTTTMIRTENGKVIEIQHNVMTPQPYNRLYQLTGTKGFANKYPISGYA
LAGDQLAASGVQPQVDNLSSHSFLPKSEMEALVAKYQHPILKKYGEMAKEVGGHGGMDFI
MDCRLVYCLQNGLPLDMDVYDLAEWCCLAELGTLSMDNNCAAVAFPDFTRGEWNVVKGYK
HAYASPEEEKAAEEKAAAITAELKKQGSKEWAEAE

Enzyme Prediction     

No EC number prediction in MGYG000002561_00479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	64	474	5.2e-159	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.80e-22	65	365	1	271	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.61e-13	68	193	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.33e-07	66	218	3	145	putative oxidoreductase; Provisional
COG4091	COG4091	0.003	68	164	18	129	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59362.1	0.0	1	515	1	512
QUT89581.1	0.0	1	515	1	512
QUU00485.1	0.0	1	513	1	511
BBK85756.1	0.0	1	513	1	511
QUT62233.1	0.0	1	513	1	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.41e-82	50	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	9.28e-71	68	477	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	3.04e-08	58	218	3	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3EVN_A	1.43e-06	68	219	6	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
3E18_A	1.59e-06	127	247	55	177	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	512	1	511	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	512	1	512	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	2.13e-242	3	500	2	494	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6KX96	2.47e-210	3	484	4	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	8.67e-210	5	484	2	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000048	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_00479.